Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PASPSANATTMKPPPRRPPGNISWTFSSSSLSIKWDPVVPFRNESAVTGYKMLYQNDLHLTPTLHLTGKNWIEIPVPEDIGHALVQIRTTGPGGDGIPAEVHIVRNGGTSMMVENMAVRPAPHPGTVISHSVAMLIL |
| Gene Sequence | PASPSANATTMKPPPRRPPGNISWTFSSSSLSIKWDPVVPFRNESAVTGYKMLYQNDLHLTPTLHLTGKNWIEIPVPEDIGHALVQIRTTGPGGDGIPAEVHIVRNGGTSMMVENMAVRPAPHPGTVISHSVAMLIL |
| Gene ID - Mouse | ENSMUSG00000053024 |
| Gene ID - Rat | ENSRNOG00000009033 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CNTN2 pAb (ATL-HPA001397) | |
| Datasheet | Anti CNTN2 pAb (ATL-HPA001397) Datasheet (External Link) |
| Vendor Page | Anti CNTN2 pAb (ATL-HPA001397) at Atlas Antibodies |
| Documents & Links for Anti CNTN2 pAb (ATL-HPA001397) | |
| Datasheet | Anti CNTN2 pAb (ATL-HPA001397) Datasheet (External Link) |
| Vendor Page | Anti CNTN2 pAb (ATL-HPA001397) |
| Citations for Anti CNTN2 pAb (ATL-HPA001397) – 2 Found |
| Chatterjee, Madhurima; Del Campo, Marta; Morrema, Tjado H J; de Waal, Matthijs; van der Flier, Wiesje M; Hoozemans, Jeroen J M; Teunissen, Charlotte E. Contactin-2, a synaptic and axonal protein, is reduced in cerebrospinal fluid and brain tissue in Alzheimer's disease. Alzheimer's Research & Therapy. 2018;10(1):52. PubMed |
| Chatterjee, Madhurima; van Steenoven, Inger; Huisman, Evelien; Oosterveld, Linda; Berendse, Henk; van der Flier, Wiesje M; Del Campo, Marta; Lemstra, Afina W; van de Berg, Wilma D J; Teunissen, Charlotte E. Contactin-1 Is Reduced in Cerebrospinal Fluid of Parkinson's Disease Patients and Is Present within Lewy Bodies. Biomolecules. 2020;10(8) PubMed |


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PASPSANATTMKPPPRRPPGNISWTFSSSSLSIKWDPVVPFRNESAVTGYKMLYQNDLHLTPTLHLTGKNWIEIPVPEDIGHALVQIRTTGPGGDGIPAEVHIVRNGGTSMMVENMAVRPAPHPGTVISHSVAMLIL |
| Gene Sequence | PASPSANATTMKPPPRRPPGNISWTFSSSSLSIKWDPVVPFRNESAVTGYKMLYQNDLHLTPTLHLTGKNWIEIPVPEDIGHALVQIRTTGPGGDGIPAEVHIVRNGGTSMMVENMAVRPAPHPGTVISHSVAMLIL |
| Gene ID - Mouse | ENSMUSG00000053024 |
| Gene ID - Rat | ENSRNOG00000009033 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CNTN2 pAb (ATL-HPA001397) | |
| Datasheet | Anti CNTN2 pAb (ATL-HPA001397) Datasheet (External Link) |
| Vendor Page | Anti CNTN2 pAb (ATL-HPA001397) at Atlas Antibodies |
| Documents & Links for Anti CNTN2 pAb (ATL-HPA001397) | |
| Datasheet | Anti CNTN2 pAb (ATL-HPA001397) Datasheet (External Link) |
| Vendor Page | Anti CNTN2 pAb (ATL-HPA001397) |
| Citations for Anti CNTN2 pAb (ATL-HPA001397) – 2 Found |
| Chatterjee, Madhurima; Del Campo, Marta; Morrema, Tjado H J; de Waal, Matthijs; van der Flier, Wiesje M; Hoozemans, Jeroen J M; Teunissen, Charlotte E. Contactin-2, a synaptic and axonal protein, is reduced in cerebrospinal fluid and brain tissue in Alzheimer's disease. Alzheimer's Research & Therapy. 2018;10(1):52. PubMed |
| Chatterjee, Madhurima; van Steenoven, Inger; Huisman, Evelien; Oosterveld, Linda; Berendse, Henk; van der Flier, Wiesje M; Del Campo, Marta; Lemstra, Afina W; van de Berg, Wilma D J; Teunissen, Charlotte E. Contactin-1 Is Reduced in Cerebrospinal Fluid of Parkinson's Disease Patients and Is Present within Lewy Bodies. Biomolecules. 2020;10(8) PubMed |