Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies


![Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human cell line HepG2](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/57604/46476/atl-hpa057768_anti-coa5-pab-atl-hpa057768_57975__62621.1783643163.jpg?compression=lossy)


![Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human cell line HepG2](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/57604/46476/atl-hpa057768_anti-coa5-pab-atl-hpa057768_57975__62621.1783643163.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PKYYEDKPQGGACAGLKEDLGACLLQSDCVVQEGKSPRQCLKEGYCNSLKYAFFECKRSVLDNRARFR |
| Gene Sequence | PKYYEDKPQGGACAGLKEDLGACLLQSDCVVQEGKSPRQCLKEGYCNSLKYAFFECKRSVLDNRARFR |
| Gene ID - Mouse | ENSMUSG00000026112 |
| Gene ID - Rat | ENSRNOG00000018102 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti COA5 pAb (ATL-HPA057768) | |
| Datasheet | Anti COA5 pAb (ATL-HPA057768) Datasheet (External Link) |
| Vendor Page | Anti COA5 pAb (ATL-HPA057768) at Atlas Antibodies |
| Documents & Links for Anti COA5 pAb (ATL-HPA057768) | |
| Datasheet | Anti COA5 pAb (ATL-HPA057768) Datasheet (External Link) |
| Vendor Page | Anti COA5 pAb (ATL-HPA057768) |
| Citations for Anti COA5 pAb (ATL-HPA057768) – 1 Found |
| Nývltová, Eva; Dietz, Jonathan V; Seravalli, Javier; Khalimonchuk, Oleh; Barrientos, Antoni. Coordination of metal center biogenesis in human cytochrome c oxidase. Nature Communications. 2022;13(1):3615. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies


![Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human cell line HepG2](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/57604/46476/atl-hpa057768_anti-coa5-pab-atl-hpa057768_57975__62621.1783643163.jpg?compression=lossy)


![Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human cell line HepG2](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/57604/46476/atl-hpa057768_anti-coa5-pab-atl-hpa057768_57975__62621.1783643163.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PKYYEDKPQGGACAGLKEDLGACLLQSDCVVQEGKSPRQCLKEGYCNSLKYAFFECKRSVLDNRARFR |
| Gene Sequence | PKYYEDKPQGGACAGLKEDLGACLLQSDCVVQEGKSPRQCLKEGYCNSLKYAFFECKRSVLDNRARFR |
| Gene ID - Mouse | ENSMUSG00000026112 |
| Gene ID - Rat | ENSRNOG00000018102 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti COA5 pAb (ATL-HPA057768) | |
| Datasheet | Anti COA5 pAb (ATL-HPA057768) Datasheet (External Link) |
| Vendor Page | Anti COA5 pAb (ATL-HPA057768) at Atlas Antibodies |
| Documents & Links for Anti COA5 pAb (ATL-HPA057768) | |
| Datasheet | Anti COA5 pAb (ATL-HPA057768) Datasheet (External Link) |
| Vendor Page | Anti COA5 pAb (ATL-HPA057768) |
| Citations for Anti COA5 pAb (ATL-HPA057768) – 1 Found |
| Nývltová, Eva; Dietz, Jonathan V; Seravalli, Javier; Khalimonchuk, Oleh; Barrientos, Antoni. Coordination of metal center biogenesis in human cytochrome c oxidase. Nature Communications. 2022;13(1):3615. PubMed |