Related products

No related products found

Try browsing our complete catalog of products.

Reviews 0

No reviews have been added for this product.

Reviews

Protein Description: cytochrome c oxidase assembly factor 6 homolog (S. cerevisiae)
Gene Name: COA6
Alternative Gene Name: C1orf31
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051671: 80%, ENSRNOG00000052701: 76%
Entrez Gene ID: 388753
Uniprot ID: Q5JTJ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application	IHC
Reactivity	Human
Clonality	Polyclonal
Host	Rabbit
Immunogen	PSMKERQVCWGARDEYWKCLDENLEDASQCKKLRSSFESSCPQQWIKYFDKRRDYLKFKEKFEAGQFEPSETTA
Gene Sequence	PSMKERQVCWGARDEYWKCLDENLEDASQCKKLRSSFESSCPQQWIKYFDKRRDYLKFKEKFEAGQFEPSETTA
Gene ID - Mouse	ENSMUSG00000051671
Gene ID - Rat	ENSRNOG00000052701
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti COA6 pAb (ATL-HPA028588)
Datasheet	Anti COA6 pAb (ATL-HPA028588) Datasheet (External Link)
Vendor Page	Anti COA6 pAb (ATL-HPA028588) at Atlas Antibodies

Documents & Links for Anti COA6 pAb (ATL-HPA028588)
Datasheet	Anti COA6 pAb (ATL-HPA028588) Datasheet (External Link)
Vendor Page	Anti COA6 pAb (ATL-HPA028588)

Citations for Anti COA6 pAb (ATL-HPA028588) – 1 Found

Nývltová, Eva; Dietz, Jonathan V; Seravalli, Javier; Khalimonchuk, Oleh; Barrientos, Antoni. Coordination of metal center biogenesis in human cytochrome c oxidase. Nature Communications. 2022;13(1):3615. PubMed

No related products found

Reviews 0

Reviews

Anti COA6 pAb (ATL-HPA028588)

Additional information

Specifications

Reviews 0

Anti COA6 pAb (ATL-HPA028588)

Additional information

Specifications

No related products found

Anti COA6 pAb (ATL-HPA028588)

Additional information

Anti COA6 pAb (ATL-HPA028588)

Additional information

Specifications

Specifications