Related products

No related products found

Try browsing our complete catalog of products.

Reviews 0

No reviews have been added for this product.

Reviews

Protein Description: cordon-bleu WH2 repeat protein
Gene Name: COBL
Alternative Gene Name: KIAA0633
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020173: 45%, ENSRNOG00000004281: 46%
Entrez Gene ID: 23242
Uniprot ID: O75128
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application	IHC
Reactivity	Human
Clonality	Polyclonal
Host	Rabbit
Immunogen	KSAHHEGRNPLGEGRNQPPTMGMGHVRVPAAHTTEVTFLKPQRRTSSQYVASAIAKRIGAPKVHADVVRPHGYAEKGYAGKAPVLAAPPVTVKDDRTSSPHSETQGWKDGAQWPCVTPPNNHGEDLAVGA
Gene Sequence	KSAHHEGRNPLGEGRNQPPTMGMGHVRVPAAHTTEVTFLKPQRRTSSQYVASAIAKRIGAPKVHADVVRPHGYAEKGYAGKAPVLAAPPVTVKDDRTSSPHSETQGWKDGAQWPCVTPPNNHGEDLAVGA
Gene ID - Mouse	ENSMUSG00000020173
Gene ID - Rat	ENSRNOG00000004281
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti COBL pAb (ATL-HPA019033 w/enhanced validation)
Datasheet	Anti COBL pAb (ATL-HPA019033 w/enhanced validation) Datasheet (External Link)
Vendor Page	Anti COBL pAb (ATL-HPA019033 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti COBL pAb (ATL-HPA019033 w/enhanced validation)
Datasheet	Anti COBL pAb (ATL-HPA019033 w/enhanced validation) Datasheet (External Link)
Vendor Page	Anti COBL pAb (ATL-HPA019033 w/enhanced validation)

Citations for Anti COBL pAb (ATL-HPA019033 w/enhanced validation) – 2 Found

Grega-Larson, Nathan E; Crawley, Scott W; Erwin, Amanda L; Tyska, Matthew J. Cordon bleu promotes the assembly of brush border microvilli. Molecular Biology Of The Cell. 2015;26(21):3803-15. PubMed

Postema, Meagan M; Grega-Larson, Nathan E; Meenderink, Leslie M; Tyska, Matthew J. PACSIN2-dependent apical endocytosis regulates the morphology of epithelial microvilli. Molecular Biology Of The Cell. 2019;30(19):2515-2526. PubMed

No related products found

Reviews 0

Reviews

Anti COBL pAb (ATL-HPA019033 w/enhanced validation)

Additional information

Anti COBL pAb (ATL-HPA019033 w/enhanced validation)

Additional information

Specifications

No related products found

Reviews 0

Anti COBL pAb (ATL-HPA019033 w/enhanced validation)

Additional information

Specifications

Anti COBL pAb (ATL-HPA019033 w/enhanced validation)

Additional information

Specifications

Specifications