Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AVVRVSPEVPLQNILPVICAKCEVSPEHVVLLRDNIAGEELELSKSLNELGIKELYAWDNRRETFRKSSLGNDETDKEKKKFLGFFKVNKRSNSKGCLT |
| Gene Sequence | AVVRVSPEVPLQNILPVICAKCEVSPEHVVLLRDNIAGEELELSKSLNELGIKELYAWDNRRETFRKSSLGNDETDKEKKKFLGFFKVNKRSNSKGCLT |
| Gene ID - Mouse | ENSMUSG00000020173 |
| Gene ID - Rat | ENSRNOG00000004281 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti COBL pAb (ATL-HPA019167 w/enhanced validation) | |
| Datasheet | Anti COBL pAb (ATL-HPA019167 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti COBL pAb (ATL-HPA019167 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti COBL pAb (ATL-HPA019167 w/enhanced validation) | |
| Datasheet | Anti COBL pAb (ATL-HPA019167 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti COBL pAb (ATL-HPA019167 w/enhanced validation) |
| Citations for Anti COBL pAb (ATL-HPA019167 w/enhanced validation) – 2 Found |
| Grega-Larson, Nathan E; Crawley, Scott W; Erwin, Amanda L; Tyska, Matthew J. Cordon bleu promotes the assembly of brush border microvilli. Molecular Biology Of The Cell. 2015;26(21):3803-15. PubMed |
| Cracknell, Tobias; Mannsverk, Steinar; Nichols, Angus; Dowle, Adam; Blanco, Gonzalo. Proteomic resolution of IGFN1 complexes reveals a functional interaction with the actin nucleating protein COBL. Experimental Cell Research. 2020;395(2):112179. PubMed |
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AVVRVSPEVPLQNILPVICAKCEVSPEHVVLLRDNIAGEELELSKSLNELGIKELYAWDNRRETFRKSSLGNDETDKEKKKFLGFFKVNKRSNSKGCLT |
| Gene Sequence | AVVRVSPEVPLQNILPVICAKCEVSPEHVVLLRDNIAGEELELSKSLNELGIKELYAWDNRRETFRKSSLGNDETDKEKKKFLGFFKVNKRSNSKGCLT |
| Gene ID - Mouse | ENSMUSG00000020173 |
| Gene ID - Rat | ENSRNOG00000004281 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti COBL pAb (ATL-HPA019167 w/enhanced validation) | |
| Datasheet | Anti COBL pAb (ATL-HPA019167 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti COBL pAb (ATL-HPA019167 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti COBL pAb (ATL-HPA019167 w/enhanced validation) | |
| Datasheet | Anti COBL pAb (ATL-HPA019167 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti COBL pAb (ATL-HPA019167 w/enhanced validation) |
| Citations for Anti COBL pAb (ATL-HPA019167 w/enhanced validation) – 2 Found |
| Grega-Larson, Nathan E; Crawley, Scott W; Erwin, Amanda L; Tyska, Matthew J. Cordon bleu promotes the assembly of brush border microvilli. Molecular Biology Of The Cell. 2015;26(21):3803-15. PubMed |
| Cracknell, Tobias; Mannsverk, Steinar; Nichols, Angus; Dowle, Adam; Blanco, Gonzalo. Proteomic resolution of IGFN1 complexes reveals a functional interaction with the actin nucleating protein COBL. Experimental Cell Research. 2020;395(2):112179. PubMed |