Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VTTPPNQRRRTLENLIPDTKYEVSVIPEYFSGPGTPLTGNAATEEVRGNPRDLRVSDPTTSTMKLSWSGAPGKVKQYLVTYTPVAGGETQEVTVRGDTTNTVLQGLKEGTQYALSVTALYASGAG |
| Gene Sequence | VTTPPNQRRRTLENLIPDTKYEVSVIPEYFSGPGTPLTGNAATEEVRGNPRDLRVSDPTTSTMKLSWSGAPGKVKQYLVTYTPVAGGETQEVTVRGDTTNTVLQGLKEGTQYALSVTALYASGAG |
| Gene ID - Mouse | ENSMUSG00000032332 |
| Gene ID - Rat | ENSRNOG00000058470 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti COL12A1 pAb (ATL-HPA009143) | |
| Datasheet | Anti COL12A1 pAb (ATL-HPA009143) Datasheet (External Link) |
| Vendor Page | Anti COL12A1 pAb (ATL-HPA009143) at Atlas Antibodies |
| Documents & Links for Anti COL12A1 pAb (ATL-HPA009143) | |
| Datasheet | Anti COL12A1 pAb (ATL-HPA009143) Datasheet (External Link) |
| Vendor Page | Anti COL12A1 pAb (ATL-HPA009143) |
| Citations for Anti COL12A1 pAb (ATL-HPA009143) – 2 Found |
| Thant, Lay; Kaku, Masaru; Kakihara, Yoshito; Mizukoshi, Masaru; Kitami, Megumi; Arai, Moe; Kitami, Kohei; Kobayashi, Daiki; Yoshida, Yutaka; Maeda, Takeyasu; Saito, Isao; Uoshima, Katsumi; Saeki, Makio. Extracellular Matrix-Oriented Proteomic Analysis of Periodontal Ligament Under Mechanical Stress. Frontiers In Physiology. 13( 35669581):899699. PubMed |
| Tang, Zengwei; Yang, Yuan; Zhang, Qi; Liang, Tingbo. Epigenetic dysregulation-mediated COL12A1 upregulation predicts worse outcome in intrahepatic cholangiocarcinoma patients. Clinical Epigenetics. 2023;15(1):13. PubMed |
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VTTPPNQRRRTLENLIPDTKYEVSVIPEYFSGPGTPLTGNAATEEVRGNPRDLRVSDPTTSTMKLSWSGAPGKVKQYLVTYTPVAGGETQEVTVRGDTTNTVLQGLKEGTQYALSVTALYASGAG |
| Gene Sequence | VTTPPNQRRRTLENLIPDTKYEVSVIPEYFSGPGTPLTGNAATEEVRGNPRDLRVSDPTTSTMKLSWSGAPGKVKQYLVTYTPVAGGETQEVTVRGDTTNTVLQGLKEGTQYALSVTALYASGAG |
| Gene ID - Mouse | ENSMUSG00000032332 |
| Gene ID - Rat | ENSRNOG00000058470 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti COL12A1 pAb (ATL-HPA009143) | |
| Datasheet | Anti COL12A1 pAb (ATL-HPA009143) Datasheet (External Link) |
| Vendor Page | Anti COL12A1 pAb (ATL-HPA009143) at Atlas Antibodies |
| Documents & Links for Anti COL12A1 pAb (ATL-HPA009143) | |
| Datasheet | Anti COL12A1 pAb (ATL-HPA009143) Datasheet (External Link) |
| Vendor Page | Anti COL12A1 pAb (ATL-HPA009143) |
| Citations for Anti COL12A1 pAb (ATL-HPA009143) – 2 Found |
| Thant, Lay; Kaku, Masaru; Kakihara, Yoshito; Mizukoshi, Masaru; Kitami, Megumi; Arai, Moe; Kitami, Kohei; Kobayashi, Daiki; Yoshida, Yutaka; Maeda, Takeyasu; Saito, Isao; Uoshima, Katsumi; Saeki, Makio. Extracellular Matrix-Oriented Proteomic Analysis of Periodontal Ligament Under Mechanical Stress. Frontiers In Physiology. 13( 35669581):899699. PubMed |
| Tang, Zengwei; Yang, Yuan; Zhang, Qi; Liang, Tingbo. Epigenetic dysregulation-mediated COL12A1 upregulation predicts worse outcome in intrahepatic cholangiocarcinoma patients. Clinical Epigenetics. 2023;15(1):13. PubMed |