Loading...
Loading...
Loading...
Loading...
Atlas Antibodies
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RGERGSEGSPGHPGQPGPPGPPGAPGPCCGGVGAAAIAGIGGEKAGGFAPYYGDEPMDFKINTDEIMTSLKSVNGQIESLISPDGSRKNPARNCRDLKFCHPE |
| Gene Sequence | RGERGSEGSPGHPGQPGPPGPPGAPGPCCGGVGAAAIAGIGGEKAGGFAPYYGDEPMDFKINTDEIMTSLKSVNGQIESLISPDGSRKNPARNCRDLKFCHPE |
| Gene ID - Mouse | ENSMUSG00000026043 |
| Gene ID - Rat | ENSRNOG00000003357 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti COL3A1 pAb (ATL-HPA007583 w/enhanced validation) | |
| Datasheet | Anti COL3A1 pAb (ATL-HPA007583 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti COL3A1 pAb (ATL-HPA007583 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti COL3A1 pAb (ATL-HPA007583 w/enhanced validation) | |
| Datasheet | Anti COL3A1 pAb (ATL-HPA007583 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti COL3A1 pAb (ATL-HPA007583 w/enhanced validation) |
| Citations for Anti COL3A1 pAb (ATL-HPA007583 w/enhanced validation) – 3 Found |
| Gao, Yuan-Feng; Zhu, Tao; Chen, Juan; Liu, Lin; Ouyang, Rong. Knockdown of collagen α-1(III) inhibits glioma cell proliferation and migration and is regulated by miR128-3p. Oncology Letters. 2018;16(2):1917-1923. PubMed |
| Engqvist, Hanna; Parris, Toshima Z; Kovács, Anikó; Nemes, Szilárd; Werner Rönnerman, Elisabeth; De Lara, Shahin; Biermann, Jana; Sundfeldt, Karin; Karlsson, Per; Helou, Khalil. Immunohistochemical validation of COL3A1, GPR158 and PITHD1 as prognostic biomarkers in early-stage ovarian carcinomas. Bmc Cancer. 2019;19(1):928. PubMed |
| Davaadelger, Batzaya; Choi, Mi-Ran; Singhal, Hari; Clare, Susan E; Khan, Seema A; Kim, J Julie. BRCA1 mutation influences progesterone response in human benign mammary organoids. Breast Cancer Research : Bcr. 2019;21(1):124. PubMed |
No reviews have been added for this product.
Try browsing our complete catalog of products.
Atlas Antibodies
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RGERGSEGSPGHPGQPGPPGPPGAPGPCCGGVGAAAIAGIGGEKAGGFAPYYGDEPMDFKINTDEIMTSLKSVNGQIESLISPDGSRKNPARNCRDLKFCHPE |
| Gene Sequence | RGERGSEGSPGHPGQPGPPGPPGAPGPCCGGVGAAAIAGIGGEKAGGFAPYYGDEPMDFKINTDEIMTSLKSVNGQIESLISPDGSRKNPARNCRDLKFCHPE |
| Gene ID - Mouse | ENSMUSG00000026043 |
| Gene ID - Rat | ENSRNOG00000003357 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti COL3A1 pAb (ATL-HPA007583 w/enhanced validation) | |
| Datasheet | Anti COL3A1 pAb (ATL-HPA007583 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti COL3A1 pAb (ATL-HPA007583 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti COL3A1 pAb (ATL-HPA007583 w/enhanced validation) | |
| Datasheet | Anti COL3A1 pAb (ATL-HPA007583 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti COL3A1 pAb (ATL-HPA007583 w/enhanced validation) |
| Citations for Anti COL3A1 pAb (ATL-HPA007583 w/enhanced validation) – 3 Found |
| Gao, Yuan-Feng; Zhu, Tao; Chen, Juan; Liu, Lin; Ouyang, Rong. Knockdown of collagen α-1(III) inhibits glioma cell proliferation and migration and is regulated by miR128-3p. Oncology Letters. 2018;16(2):1917-1923. PubMed |
| Engqvist, Hanna; Parris, Toshima Z; Kovács, Anikó; Nemes, Szilárd; Werner Rönnerman, Elisabeth; De Lara, Shahin; Biermann, Jana; Sundfeldt, Karin; Karlsson, Per; Helou, Khalil. Immunohistochemical validation of COL3A1, GPR158 and PITHD1 as prognostic biomarkers in early-stage ovarian carcinomas. Bmc Cancer. 2019;19(1):928. PubMed |
| Davaadelger, Batzaya; Choi, Mi-Ran; Singhal, Hari; Clare, Susan E; Khan, Seema A; Kim, J Julie. BRCA1 mutation influences progesterone response in human benign mammary organoids. Breast Cancer Research : Bcr. 2019;21(1):124. PubMed |