Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies

![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/53126/39558/atl-hpa044190_anti-commd2-pab-atl-hpa044190_50768__40816.1783638468.jpg?compression=lossy)

![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/53126/39558/atl-hpa044190_anti-commd2-pab-atl-hpa044190_50768__40816.1783638468.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FVLGFSEELNKLLLQLYLDNRKEIRTLLSELAPSLPSYHNLEWRLDVQLASRSLRQQIKPAVTIKLHLNQNGDHNTKVLQTDPATLLHLVQQLEQALE |
| Gene Sequence | FVLGFSEELNKLLLQLYLDNRKEIRTLLSELAPSLPSYHNLEWRLDVQLASRSLRQQIKPAVTIKLHLNQNGDHNTKVLQTDPATLLHLVQQLEQALE |
| Gene ID - Mouse | ENSMUSG00000036513 |
| Gene ID - Rat | ENSRNOG00000043386 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti COMMD2 pAb (ATL-HPA044190) | |
| Datasheet | Anti COMMD2 pAb (ATL-HPA044190) Datasheet (External Link) |
| Vendor Page | Anti COMMD2 pAb (ATL-HPA044190) at Atlas Antibodies |
| Documents & Links for Anti COMMD2 pAb (ATL-HPA044190) | |
| Datasheet | Anti COMMD2 pAb (ATL-HPA044190) Datasheet (External Link) |
| Vendor Page | Anti COMMD2 pAb (ATL-HPA044190) |

![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/53126/39558/atl-hpa044190_anti-commd2-pab-atl-hpa044190_50768__40816.1783638468.jpg?compression=lossy)

![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/53126/39558/atl-hpa044190_anti-commd2-pab-atl-hpa044190_50768__40816.1783638468.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FVLGFSEELNKLLLQLYLDNRKEIRTLLSELAPSLPSYHNLEWRLDVQLASRSLRQQIKPAVTIKLHLNQNGDHNTKVLQTDPATLLHLVQQLEQALE |
| Gene Sequence | FVLGFSEELNKLLLQLYLDNRKEIRTLLSELAPSLPSYHNLEWRLDVQLASRSLRQQIKPAVTIKLHLNQNGDHNTKVLQTDPATLLHLVQQLEQALE |
| Gene ID - Mouse | ENSMUSG00000036513 |
| Gene ID - Rat | ENSRNOG00000043386 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti COMMD2 pAb (ATL-HPA044190) | |
| Datasheet | Anti COMMD2 pAb (ATL-HPA044190) Datasheet (External Link) |
| Vendor Page | Anti COMMD2 pAb (ATL-HPA044190) at Atlas Antibodies |
| Documents & Links for Anti COMMD2 pAb (ATL-HPA044190) | |
| Datasheet | Anti COMMD2 pAb (ATL-HPA044190) Datasheet (External Link) |
| Vendor Page | Anti COMMD2 pAb (ATL-HPA044190) |