Loading...
Loading...
Loading...
Loading...
Atlas Antibodies






| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VHGNMLHYVKDRFLRQLDFNSSKDVAVMQLRSGSKFPVFNMSYNPAENAVLLCTRASNLENSTYDLYTIPKDADSQNPDAPEGKRSSGLTAVWVARN |
| Gene Sequence | VHGNMLHYVKDRFLRQLDFNSSKDVAVMQLRSGSKFPVFNMSYNPAENAVLLCTRASNLENSTYDLYTIPKDADSQNPDAPEGKRSSGLTAVWVARN |
| Gene ID - Mouse | ENSMUSG00000026553 |
| Gene ID - Rat | ENSRNOG00000006247 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti COPA pAb (ATL-HPA028024) | |
| Datasheet | Anti COPA pAb (ATL-HPA028024) Datasheet (External Link) |
| Vendor Page | Anti COPA pAb (ATL-HPA028024) at Atlas Antibodies |
| Documents & Links for Anti COPA pAb (ATL-HPA028024) | |
| Datasheet | Anti COPA pAb (ATL-HPA028024) Datasheet (External Link) |
| Vendor Page | Anti COPA pAb (ATL-HPA028024) |
| Citations for Anti COPA pAb (ATL-HPA028024) – 7 Found |
| Peng, Xinxin; Xu, Xiaoyan; Wang, Yumeng; Hawke, David H; Yu, Shuangxing; Han, Leng; Zhou, Zhicheng; Mojumdar, Kamalika; Jeong, Kang Jin; Labrie, Marilyne; Tsang, Yiu Huen; Zhang, Minying; Lu, Yiling; Hwu, Patrick; Scott, Kenneth L; Liang, Han; Mills, Gordon B. A-to-I RNA Editing Contributes to Proteomic Diversity in Cancer. Cancer Cell. 2018;33(5):817-828.e7. PubMed |
| Zhang, Feng; Wang, Yaqing; Wang, Tao; Yao, Li; Lam, Sin Man; Huang, Xiahe; Fan, Junwan; Wang, Qin; Liu, Liang; Jiang, Yisheng; Zhang, Hongsheng; Shi, Lei; Yu, Mei; Shui, Guanghou; Wang, Yingchun; Gao, Fei; Zhang, Xiaohui; Xu, Zhiheng. cTAGE5/MEA6 plays a critical role in neuronal cellular components trafficking and brain development. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2018;115(40):E9449-E9458. PubMed |
| Estrin, Michael A; Hussein, Islam T M; Puryear, Wendy B; Kuan, Anne C; Artim, Stephen C; Runstadler, Jonathan A. Host-directed combinatorial RNAi improves inhibition of diverse strains of influenza A virus in human respiratory epithelial cells. Plos One. 13(5):e0197246. PubMed |
| Deng, Zimu; Law, Christopher S; Ho, Frances O; Wang, Kristin M; Jones, Kirk D; Shin, Jeoung-Sook; Shum, Anthony K. A Defect in Thymic Tolerance Causes T Cell-Mediated Autoimmunity in a Murine Model of COPA Syndrome. Journal Of Immunology (Baltimore, Md. : 1950). 2020;204(9):2360-2373. PubMed |
| Mukai, Kojiro; Ogawa, Emari; Uematsu, Rei; Kuchitsu, Yoshihiko; Kiku, Fumika; Uemura, Takefumi; Waguri, Satoshi; Suzuki, Takehiro; Dohmae, Naoshi; Arai, Hiroyuki; Shum, Anthony K; Taguchi, Tomohiko. Homeostatic regulation of STING by retrograde membrane traffic to the ER. Nature Communications. 2021;12(1):61. PubMed |
| Stewart, Lorna M; Gerner, Lisa; Rettel, Mandy; Stein, Frank; Burrows, James F; Mills, Ian G; Evergren, Emma. CaMKK2 facilitates Golgi-associated vesicle trafficking to sustain cancer cell proliferation. Cell Death & Disease. 2021;12(11):1040. PubMed |
| Harwood, Mara C; Woo, Tai-Ting; Takeo, Yuka; DiMaio, Daniel; Tsai, Billy. HPV is a cargo for the COPI sorting complex during virus entry. Science Advances. 2023;9(3):eadc9830. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies






| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VHGNMLHYVKDRFLRQLDFNSSKDVAVMQLRSGSKFPVFNMSYNPAENAVLLCTRASNLENSTYDLYTIPKDADSQNPDAPEGKRSSGLTAVWVARN |
| Gene Sequence | VHGNMLHYVKDRFLRQLDFNSSKDVAVMQLRSGSKFPVFNMSYNPAENAVLLCTRASNLENSTYDLYTIPKDADSQNPDAPEGKRSSGLTAVWVARN |
| Gene ID - Mouse | ENSMUSG00000026553 |
| Gene ID - Rat | ENSRNOG00000006247 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti COPA pAb (ATL-HPA028024) | |
| Datasheet | Anti COPA pAb (ATL-HPA028024) Datasheet (External Link) |
| Vendor Page | Anti COPA pAb (ATL-HPA028024) at Atlas Antibodies |
| Documents & Links for Anti COPA pAb (ATL-HPA028024) | |
| Datasheet | Anti COPA pAb (ATL-HPA028024) Datasheet (External Link) |
| Vendor Page | Anti COPA pAb (ATL-HPA028024) |
| Citations for Anti COPA pAb (ATL-HPA028024) – 7 Found |
| Peng, Xinxin; Xu, Xiaoyan; Wang, Yumeng; Hawke, David H; Yu, Shuangxing; Han, Leng; Zhou, Zhicheng; Mojumdar, Kamalika; Jeong, Kang Jin; Labrie, Marilyne; Tsang, Yiu Huen; Zhang, Minying; Lu, Yiling; Hwu, Patrick; Scott, Kenneth L; Liang, Han; Mills, Gordon B. A-to-I RNA Editing Contributes to Proteomic Diversity in Cancer. Cancer Cell. 2018;33(5):817-828.e7. PubMed |
| Zhang, Feng; Wang, Yaqing; Wang, Tao; Yao, Li; Lam, Sin Man; Huang, Xiahe; Fan, Junwan; Wang, Qin; Liu, Liang; Jiang, Yisheng; Zhang, Hongsheng; Shi, Lei; Yu, Mei; Shui, Guanghou; Wang, Yingchun; Gao, Fei; Zhang, Xiaohui; Xu, Zhiheng. cTAGE5/MEA6 plays a critical role in neuronal cellular components trafficking and brain development. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2018;115(40):E9449-E9458. PubMed |
| Estrin, Michael A; Hussein, Islam T M; Puryear, Wendy B; Kuan, Anne C; Artim, Stephen C; Runstadler, Jonathan A. Host-directed combinatorial RNAi improves inhibition of diverse strains of influenza A virus in human respiratory epithelial cells. Plos One. 13(5):e0197246. PubMed |
| Deng, Zimu; Law, Christopher S; Ho, Frances O; Wang, Kristin M; Jones, Kirk D; Shin, Jeoung-Sook; Shum, Anthony K. A Defect in Thymic Tolerance Causes T Cell-Mediated Autoimmunity in a Murine Model of COPA Syndrome. Journal Of Immunology (Baltimore, Md. : 1950). 2020;204(9):2360-2373. PubMed |
| Mukai, Kojiro; Ogawa, Emari; Uematsu, Rei; Kuchitsu, Yoshihiko; Kiku, Fumika; Uemura, Takefumi; Waguri, Satoshi; Suzuki, Takehiro; Dohmae, Naoshi; Arai, Hiroyuki; Shum, Anthony K; Taguchi, Tomohiko. Homeostatic regulation of STING by retrograde membrane traffic to the ER. Nature Communications. 2021;12(1):61. PubMed |
| Stewart, Lorna M; Gerner, Lisa; Rettel, Mandy; Stein, Frank; Burrows, James F; Mills, Ian G; Evergren, Emma. CaMKK2 facilitates Golgi-associated vesicle trafficking to sustain cancer cell proliferation. Cell Death & Disease. 2021;12(11):1040. PubMed |
| Harwood, Mara C; Woo, Tai-Ting; Takeo, Yuka; DiMaio, Daniel; Tsai, Billy. HPV is a cargo for the COPI sorting complex during virus entry. Science Advances. 2023;9(3):eadc9830. PubMed |
No reviews have been added for this product.