Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies






| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MLPSILVLLKRCVMDDDNEVRDRATFYLNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEPSEKPFDLKSVPL |
| Gene Sequence | MLPSILVLLKRCVMDDDNEVRDRATFYLNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEPSEKPFDLKSVPL |
| Gene ID - Mouse | ENSMUSG00000030058 |
| Gene ID - Rat | ENSRNOG00000010474 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti COPG1 pAb (ATL-HPA037866 w/enhanced validation) | |
| Datasheet | Anti COPG1 pAb (ATL-HPA037866 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti COPG1 pAb (ATL-HPA037866 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti COPG1 pAb (ATL-HPA037866 w/enhanced validation) | |
| Datasheet | Anti COPG1 pAb (ATL-HPA037866 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti COPG1 pAb (ATL-HPA037866 w/enhanced validation) |
| Citations for Anti COPG1 pAb (ATL-HPA037866 w/enhanced validation) – 1 Found |
| Kaeser-Pebernard, Stéphanie; Vionnet, Christine; Mari, Muriel; Sankar, Devanarayanan Siva; Hu, Zehan; Roubaty, Carole; Martínez-Martínez, Esther; Zhao, Huiyuan; Spuch-Calvar, Miguel; Petri-Fink, Alke; Rainer, Gregor; Steinberg, Florian; Reggiori, Fulvio; Dengjel, Jörn. mTORC1 controls Golgi architecture and vesicle secretion by phosphorylation of SCYL1. Nature Communications. 2022;13(1):4685. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies






| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MLPSILVLLKRCVMDDDNEVRDRATFYLNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEPSEKPFDLKSVPL |
| Gene Sequence | MLPSILVLLKRCVMDDDNEVRDRATFYLNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEPSEKPFDLKSVPL |
| Gene ID - Mouse | ENSMUSG00000030058 |
| Gene ID - Rat | ENSRNOG00000010474 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti COPG1 pAb (ATL-HPA037866 w/enhanced validation) | |
| Datasheet | Anti COPG1 pAb (ATL-HPA037866 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti COPG1 pAb (ATL-HPA037866 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti COPG1 pAb (ATL-HPA037866 w/enhanced validation) | |
| Datasheet | Anti COPG1 pAb (ATL-HPA037866 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti COPG1 pAb (ATL-HPA037866 w/enhanced validation) |
| Citations for Anti COPG1 pAb (ATL-HPA037866 w/enhanced validation) – 1 Found |
| Kaeser-Pebernard, Stéphanie; Vionnet, Christine; Mari, Muriel; Sankar, Devanarayanan Siva; Hu, Zehan; Roubaty, Carole; Martínez-Martínez, Esther; Zhao, Huiyuan; Spuch-Calvar, Miguel; Petri-Fink, Alke; Rainer, Gregor; Steinberg, Florian; Reggiori, Fulvio; Dengjel, Jörn. mTORC1 controls Golgi architecture and vesicle secretion by phosphorylation of SCYL1. Nature Communications. 2022;13(1):4685. PubMed |