Related products

No related products found

Try browsing our complete catalog of products.

Reviews 0

No reviews have been added for this product.

Reviews

Protein Description: cytochrome c oxidase assembly homolog 10 (yeast)
Gene Name: COX10
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042148: 65%, ENSRNOG00000024972: 59%
Entrez Gene ID: 1352
Uniprot ID: Q12887
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application	WB, IHC
Reactivity	Human
Clonality	Polyclonal
Host	Rabbit
Immunogen	PNEKELIELEPDSVIEDSIDVGKETKEEKRWKEMKLQVYDLPGILARLS
Gene Sequence	PNEKELIELEPDSVIEDSIDVGKETKEEKRWKEMKLQVYDLPGILARLS
Gene ID - Mouse	ENSMUSG00000042148
Gene ID - Rat	ENSRNOG00000024972
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti COX10 pAb (ATL-HPA032005 w/enhanced validation)
Datasheet	Anti COX10 pAb (ATL-HPA032005 w/enhanced validation) Datasheet (External Link)
Vendor Page	Anti COX10 pAb (ATL-HPA032005 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti COX10 pAb (ATL-HPA032005 w/enhanced validation)
Datasheet	Anti COX10 pAb (ATL-HPA032005 w/enhanced validation) Datasheet (External Link)
Vendor Page	Anti COX10 pAb (ATL-HPA032005 w/enhanced validation)

Citations for Anti COX10 pAb (ATL-HPA032005 w/enhanced validation) – 2 Found

Bourens, Myriam; Barrientos, Antoni. A CMC1-knockout reveals translation-independent control of human mitochondrial complex IV biogenesis. Embo Reports. 2017;18(3):477-494. PubMed

Nývltová, Eva; Dietz, Jonathan V; Seravalli, Javier; Khalimonchuk, Oleh; Barrientos, Antoni. Coordination of metal center biogenesis in human cytochrome c oxidase. Nature Communications. 2022;13(1):3615. PubMed

No related products found

Reviews 0

Reviews

Anti COX10 pAb (ATL-HPA032005 w/enhanced validation)

Additional information

Specifications

Anti COX10 pAb (ATL-HPA032005 w/enhanced validation)

Additional information

Specifications

Reviews 0

No related products found

Anti COX10 pAb (ATL-HPA032005 w/enhanced validation)

Additional information

Anti COX10 pAb (ATL-HPA032005 w/enhanced validation)

Additional information

Specifications

Specifications