Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies


| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QVLRINVRNGDEISKLSQLVNSNNLKLNFWKSPSSFNRPVDVLVPSVSLQAFKSFLRSQGLEYAVTIEDLQALLDNEDDEMQHNEGQERSSNNFNYGAYHSLEAIYHEMDNIAADFP |
| Gene Sequence | QVLRINVRNGDEISKLSQLVNSNNLKLNFWKSPSSFNRPVDVLVPSVSLQAFKSFLRSQGLEYAVTIEDLQALLDNEDDEMQHNEGQERSSNNFNYGAYHSLEAIYHEMDNIAADFP |
| Gene ID - Mouse | ENSMUSG00000039070 |
| Gene ID - Rat | ENSRNOG00000010463 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CPA4 pAb (ATL-HPA021030) | |
| Datasheet | Anti CPA4 pAb (ATL-HPA021030) Datasheet (External Link) |
| Vendor Page | Anti CPA4 pAb (ATL-HPA021030) at Atlas Antibodies |
| Documents & Links for Anti CPA4 pAb (ATL-HPA021030) | |
| Datasheet | Anti CPA4 pAb (ATL-HPA021030) Datasheet (External Link) |
| Vendor Page | Anti CPA4 pAb (ATL-HPA021030) |
| Citations for Anti CPA4 pAb (ATL-HPA021030) – 5 Found |
| Sun, Lichao; Burnett, Joseph; Guo, Chunguang; Xie, Yibin; Pan, Jian; Yang, Zhihua; Ran, Yuliang; Sun, Duxin. CPA4 is a promising diagnostic serum biomarker for pancreatic cancer. American Journal Of Cancer Research. 6(1):91-6. PubMed |
| Handa, Tadashi; Katayama, Ayaka; Yokobori, Takehiko; Yamane, Arito; Fujii, Takaaki; Obayashi, Sayaka; Kurozumi, Sasagu; Kawabata-Iwakawa, Reika; Gombodorj, Navchaa; Nishiyama, Masahiko; Asao, Takayuki; Shirabe, Ken; Kuwano, Hiroyuki; Oyama, Tetsunari. Carboxypeptidase A4 accumulation is associated with an aggressive phenotype and poor prognosis in triple-negative breast cancer. International Journal Of Oncology. 2019;54(3):833-844. PubMed |
| Sun, Lichao; Guo, Chunguang; Yuan, Hebao; Burnett, Joseph; Pan, Jian; Yang, Zhihua; Ran, Yuliang; Myers, Ila; Sun, Duxin. Overexpression of carboxypeptidase A4 (CPA4) is associated with poor prognosis in patients with gastric cancer. American Journal Of Translational Research. 8(11):5071-5075. PubMed |
| Sun, Lichao; Guo, Chunguang; Burnett, Joseph; Pan, Jian; Yang, Zhihua; Ran, Yuliang; Sun, Duxin. Association between expression of Carboxypeptidase 4 and stem cell markers and their clinical significance in liver cancer development. Journal Of Cancer. 8(1):111-116. PubMed |
| Wang, Yipeng; Xie, Yibin; Niu, Yanan; Song, Peng; Liu, Ye; Burnett, Joseph; Yang, Zhihua; Sun, Duxin; Ran, Yuliang; Li, Yang; Sun, Lichao. Carboxypeptidase A4 negatively correlates with p53 expression and regulates the stemness of breast cancer cells. International Journal Of Medical Sciences. 18(8):1753-1759. PubMed |


| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QVLRINVRNGDEISKLSQLVNSNNLKLNFWKSPSSFNRPVDVLVPSVSLQAFKSFLRSQGLEYAVTIEDLQALLDNEDDEMQHNEGQERSSNNFNYGAYHSLEAIYHEMDNIAADFP |
| Gene Sequence | QVLRINVRNGDEISKLSQLVNSNNLKLNFWKSPSSFNRPVDVLVPSVSLQAFKSFLRSQGLEYAVTIEDLQALLDNEDDEMQHNEGQERSSNNFNYGAYHSLEAIYHEMDNIAADFP |
| Gene ID - Mouse | ENSMUSG00000039070 |
| Gene ID - Rat | ENSRNOG00000010463 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CPA4 pAb (ATL-HPA021030) | |
| Datasheet | Anti CPA4 pAb (ATL-HPA021030) Datasheet (External Link) |
| Vendor Page | Anti CPA4 pAb (ATL-HPA021030) at Atlas Antibodies |
| Documents & Links for Anti CPA4 pAb (ATL-HPA021030) | |
| Datasheet | Anti CPA4 pAb (ATL-HPA021030) Datasheet (External Link) |
| Vendor Page | Anti CPA4 pAb (ATL-HPA021030) |
| Citations for Anti CPA4 pAb (ATL-HPA021030) – 5 Found |
| Sun, Lichao; Burnett, Joseph; Guo, Chunguang; Xie, Yibin; Pan, Jian; Yang, Zhihua; Ran, Yuliang; Sun, Duxin. CPA4 is a promising diagnostic serum biomarker for pancreatic cancer. American Journal Of Cancer Research. 6(1):91-6. PubMed |
| Handa, Tadashi; Katayama, Ayaka; Yokobori, Takehiko; Yamane, Arito; Fujii, Takaaki; Obayashi, Sayaka; Kurozumi, Sasagu; Kawabata-Iwakawa, Reika; Gombodorj, Navchaa; Nishiyama, Masahiko; Asao, Takayuki; Shirabe, Ken; Kuwano, Hiroyuki; Oyama, Tetsunari. Carboxypeptidase A4 accumulation is associated with an aggressive phenotype and poor prognosis in triple-negative breast cancer. International Journal Of Oncology. 2019;54(3):833-844. PubMed |
| Sun, Lichao; Guo, Chunguang; Yuan, Hebao; Burnett, Joseph; Pan, Jian; Yang, Zhihua; Ran, Yuliang; Myers, Ila; Sun, Duxin. Overexpression of carboxypeptidase A4 (CPA4) is associated with poor prognosis in patients with gastric cancer. American Journal Of Translational Research. 8(11):5071-5075. PubMed |
| Sun, Lichao; Guo, Chunguang; Burnett, Joseph; Pan, Jian; Yang, Zhihua; Ran, Yuliang; Sun, Duxin. Association between expression of Carboxypeptidase 4 and stem cell markers and their clinical significance in liver cancer development. Journal Of Cancer. 8(1):111-116. PubMed |
| Wang, Yipeng; Xie, Yibin; Niu, Yanan; Song, Peng; Liu, Ye; Burnett, Joseph; Yang, Zhihua; Sun, Duxin; Ran, Yuliang; Li, Yang; Sun, Lichao. Carboxypeptidase A4 negatively correlates with p53 expression and regulates the stemness of breast cancer cells. International Journal Of Medical Sciences. 18(8):1753-1759. PubMed |