Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE |
| Gene Sequence | IKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE |
| Gene ID - Mouse | ENSMUSG00000004885 |
| Gene ID - Rat | ENSRNOG00000022101 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CRABP2 pAb (ATL-HPA004135 w/enhanced validation) | |
| Datasheet | Anti CRABP2 pAb (ATL-HPA004135 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CRABP2 pAb (ATL-HPA004135 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CRABP2 pAb (ATL-HPA004135 w/enhanced validation) | |
| Datasheet | Anti CRABP2 pAb (ATL-HPA004135 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CRABP2 pAb (ATL-HPA004135 w/enhanced validation) |
| Citations for Anti CRABP2 pAb (ATL-HPA004135 w/enhanced validation) – 2 Found |
| Seidensaal, Katharina; Nollert, Andre; Feige, Agnes Hiou; Muller, Marie; Fleming, Thomas; Gunkel, Nikolas; Zaoui, Karim; Grabe, Niels; Weichert, Wilko; Weber, Klaus-Josef; Plinkert, Peter; Simon, Christian; Hess, Jochen. Impaired aldehyde dehydrogenase 1 subfamily member 2A-dependent retinoic acid signaling is related with a mesenchymal-like phenotype and an unfavorable prognosis of head and neck squamous cell carcinoma. Molecular Cancer. 2015;14( 26634247):204. PubMed |
| Ozaki, Rie; Kuroda, Keiji; Ikemoto, Yuko; Ochiai, Asako; Matsumoto, Akemi; Kumakiri, Jun; Kitade, Mari; Itakura, Atsuo; Muter, Joanne; Brosens, Jan J; Takeda, Satoru. Reprogramming of the retinoic acid pathway in decidualizing human endometrial stromal cells. Plos One. 12(3):e0173035. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE |
| Gene Sequence | IKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE |
| Gene ID - Mouse | ENSMUSG00000004885 |
| Gene ID - Rat | ENSRNOG00000022101 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CRABP2 pAb (ATL-HPA004135 w/enhanced validation) | |
| Datasheet | Anti CRABP2 pAb (ATL-HPA004135 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CRABP2 pAb (ATL-HPA004135 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CRABP2 pAb (ATL-HPA004135 w/enhanced validation) | |
| Datasheet | Anti CRABP2 pAb (ATL-HPA004135 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CRABP2 pAb (ATL-HPA004135 w/enhanced validation) |
| Citations for Anti CRABP2 pAb (ATL-HPA004135 w/enhanced validation) – 2 Found |
| Seidensaal, Katharina; Nollert, Andre; Feige, Agnes Hiou; Muller, Marie; Fleming, Thomas; Gunkel, Nikolas; Zaoui, Karim; Grabe, Niels; Weichert, Wilko; Weber, Klaus-Josef; Plinkert, Peter; Simon, Christian; Hess, Jochen. Impaired aldehyde dehydrogenase 1 subfamily member 2A-dependent retinoic acid signaling is related with a mesenchymal-like phenotype and an unfavorable prognosis of head and neck squamous cell carcinoma. Molecular Cancer. 2015;14( 26634247):204. PubMed |
| Ozaki, Rie; Kuroda, Keiji; Ikemoto, Yuko; Ochiai, Asako; Matsumoto, Akemi; Kumakiri, Jun; Kitade, Mari; Itakura, Atsuo; Muter, Joanne; Brosens, Jan J; Takeda, Satoru. Reprogramming of the retinoic acid pathway in decidualizing human endometrial stromal cells. Plos One. 12(3):e0173035. PubMed |