Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | IHC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LNESDFLNNAHFPEHLDHFTENMEDFSNDLFSSFFDDPVLDEKSPLLDMELDSPTPGIQAEHSYSLSGDSAPQSPLVPIKMEDTTQDAEHGAWALGHKLCSIMVKQE |
| Gene Sequence | LNESDFLNNAHFPEHLDHFTENMEDFSNDLFSSFFDDPVLDEKSPLLDMELDSPTPGIQAEHSYSLSGDSAPQSPLVPIKMEDTTQDAEHGAWALGHKLCSIMVKQE |
| Gene ID - Mouse | ENSMUSG00000027230 |
| Gene ID - Rat | ENSRNOG00000005413 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CREB3L1 pAb (ATL-HPA024069 w/enhanced validation) | |
| Datasheet | Anti CREB3L1 pAb (ATL-HPA024069 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CREB3L1 pAb (ATL-HPA024069 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CREB3L1 pAb (ATL-HPA024069 w/enhanced validation) | |
| Datasheet | Anti CREB3L1 pAb (ATL-HPA024069 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CREB3L1 pAb (ATL-HPA024069 w/enhanced validation) |
| Citations for Anti CREB3L1 pAb (ATL-HPA024069 w/enhanced validation) – 2 Found |
| Feng, Yu-Xiong; Jin, Dexter X; Sokol, Ethan S; Reinhardt, Ferenc; Miller, Daniel H; Gupta, Piyush B. Cancer-specific PERK signaling drives invasion and metastasis through CREB3L1. Nature Communications. 2017;8(1):1079. PubMed |
| Greenwood, Mingkwan; Paterson, Alex; Rahman, Parveen Akhter; Gillard, Benjamin Thomas; Langley, Sydney; Iwasaki, Yasumasa; Murphy, David; Greenwood, Michael Paul. Transcription factor Creb3l1 regulates the synthesis of prohormone convertase enzyme PC1/3 in endocrine cells. Journal Of Neuroendocrinology. 2020;32(4):e12851. PubMed |
| Product Specifications | |
| Application | IHC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LNESDFLNNAHFPEHLDHFTENMEDFSNDLFSSFFDDPVLDEKSPLLDMELDSPTPGIQAEHSYSLSGDSAPQSPLVPIKMEDTTQDAEHGAWALGHKLCSIMVKQE |
| Gene Sequence | LNESDFLNNAHFPEHLDHFTENMEDFSNDLFSSFFDDPVLDEKSPLLDMELDSPTPGIQAEHSYSLSGDSAPQSPLVPIKMEDTTQDAEHGAWALGHKLCSIMVKQE |
| Gene ID - Mouse | ENSMUSG00000027230 |
| Gene ID - Rat | ENSRNOG00000005413 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CREB3L1 pAb (ATL-HPA024069 w/enhanced validation) | |
| Datasheet | Anti CREB3L1 pAb (ATL-HPA024069 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CREB3L1 pAb (ATL-HPA024069 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CREB3L1 pAb (ATL-HPA024069 w/enhanced validation) | |
| Datasheet | Anti CREB3L1 pAb (ATL-HPA024069 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CREB3L1 pAb (ATL-HPA024069 w/enhanced validation) |
| Citations for Anti CREB3L1 pAb (ATL-HPA024069 w/enhanced validation) – 2 Found |
| Feng, Yu-Xiong; Jin, Dexter X; Sokol, Ethan S; Reinhardt, Ferenc; Miller, Daniel H; Gupta, Piyush B. Cancer-specific PERK signaling drives invasion and metastasis through CREB3L1. Nature Communications. 2017;8(1):1079. PubMed |
| Greenwood, Mingkwan; Paterson, Alex; Rahman, Parveen Akhter; Gillard, Benjamin Thomas; Langley, Sydney; Iwasaki, Yasumasa; Murphy, David; Greenwood, Michael Paul. Transcription factor Creb3l1 regulates the synthesis of prohormone convertase enzyme PC1/3 in endocrine cells. Journal Of Neuroendocrinology. 2020;32(4):e12851. PubMed |