Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies






| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GAFPILTDLTPETTRRWKLGSHPHSTYVKMKMQRDEATFPGLYGKQVAKLGSQSRQSDRGTRL |
| Gene Sequence | GAFPILTDLTPETTRRWKLGSHPHSTYVKMKMQRDEATFPGLYGKQVAKLGSQSRQSDRGTRL |
| Gene ID - Mouse | ENSMUSG00000037286 |
| Gene ID - Rat | ENSRNOG00000015389 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CRELD1 pAb (ATL-HPA026964 w/enhanced validation) | |
| Datasheet | Anti CRELD1 pAb (ATL-HPA026964 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CRELD1 pAb (ATL-HPA026964 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CRELD1 pAb (ATL-HPA026964 w/enhanced validation) | |
| Datasheet | Anti CRELD1 pAb (ATL-HPA026964 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CRELD1 pAb (ATL-HPA026964 w/enhanced validation) |
| Citations for Anti CRELD1 pAb (ATL-HPA026964 w/enhanced validation) – 1 Found |
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |






| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GAFPILTDLTPETTRRWKLGSHPHSTYVKMKMQRDEATFPGLYGKQVAKLGSQSRQSDRGTRL |
| Gene Sequence | GAFPILTDLTPETTRRWKLGSHPHSTYVKMKMQRDEATFPGLYGKQVAKLGSQSRQSDRGTRL |
| Gene ID - Mouse | ENSMUSG00000037286 |
| Gene ID - Rat | ENSRNOG00000015389 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CRELD1 pAb (ATL-HPA026964 w/enhanced validation) | |
| Datasheet | Anti CRELD1 pAb (ATL-HPA026964 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CRELD1 pAb (ATL-HPA026964 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CRELD1 pAb (ATL-HPA026964 w/enhanced validation) | |
| Datasheet | Anti CRELD1 pAb (ATL-HPA026964 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CRELD1 pAb (ATL-HPA026964 w/enhanced validation) |
| Citations for Anti CRELD1 pAb (ATL-HPA026964 w/enhanced validation) – 1 Found |
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |