Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/49472/32986/atl-hpa036234_anti-crhbp-pab-atl-hpa036234_44001__38133.1783633922.jpg?compression=lossy)
![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/49472/32986/atl-hpa036234_anti-crhbp-pab-atl-hpa036234_44001__38133.1783633922.jpg?compression=lossy)
| Product Specifications | |
| Application | WB |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVE |
| Gene Sequence | TLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVE |
| Gene ID - Mouse | ENSMUSG00000021680 |
| Gene ID - Rat | ENSRNOG00000017890 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CRHBP pAb (ATL-HPA036234) | |
| Datasheet | Anti CRHBP pAb (ATL-HPA036234) Datasheet (External Link) |
| Vendor Page | Anti CRHBP pAb (ATL-HPA036234) at Atlas Antibodies |
| Documents & Links for Anti CRHBP pAb (ATL-HPA036234) | |
| Datasheet | Anti CRHBP pAb (ATL-HPA036234) Datasheet (External Link) |
| Vendor Page | Anti CRHBP pAb (ATL-HPA036234) |
![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/49472/32986/atl-hpa036234_anti-crhbp-pab-atl-hpa036234_44001__38133.1783633922.jpg?compression=lossy)
![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/49472/32986/atl-hpa036234_anti-crhbp-pab-atl-hpa036234_44001__38133.1783633922.jpg?compression=lossy)
| Product Specifications | |
| Application | WB |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVE |
| Gene Sequence | TLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVE |
| Gene ID - Mouse | ENSMUSG00000021680 |
| Gene ID - Rat | ENSRNOG00000017890 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CRHBP pAb (ATL-HPA036234) | |
| Datasheet | Anti CRHBP pAb (ATL-HPA036234) Datasheet (External Link) |
| Vendor Page | Anti CRHBP pAb (ATL-HPA036234) at Atlas Antibodies |
| Documents & Links for Anti CRHBP pAb (ATL-HPA036234) | |
| Datasheet | Anti CRHBP pAb (ATL-HPA036234) Datasheet (External Link) |
| Vendor Page | Anti CRHBP pAb (ATL-HPA036234) |