Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LTEYEAGVCEDENWTDDQLLGFKPCNENLIAGCNIINGKCECNTIRTCSNPFEFPSQDMCLSALKRIEEEKPDCSKARCEVQFSPRCPEDSVLIEGYAPPGECCPLP |
| Gene Sequence | LTEYEAGVCEDENWTDDQLLGFKPCNENLIAGCNIINGKCECNTIRTCSNPFEFPSQDMCLSALKRIEEEKPDCSKARCEVQFSPRCPEDSVLIEGYAPPGECCPLP |
| Gene ID - Mouse | ENSMUSG00000024074 |
| Gene ID - Rat | ENSRNOG00000004208 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CRIM1 pAb (ATL-HPA000556 w/enhanced validation) | |
| Datasheet | Anti CRIM1 pAb (ATL-HPA000556 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CRIM1 pAb (ATL-HPA000556 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CRIM1 pAb (ATL-HPA000556 w/enhanced validation) | |
| Datasheet | Anti CRIM1 pAb (ATL-HPA000556 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CRIM1 pAb (ATL-HPA000556 w/enhanced validation) |
| Citations for Anti CRIM1 pAb (ATL-HPA000556 w/enhanced validation) – 4 Found |
| Hudson, Bryan D; Hum, Nicholas R; Thomas, Cynthia B; Kohlgruber, Ayano; Sebastian, Aimy; Collette, Nicole M; Coleman, Matthew A; Christiansen, Blaine A; Loots, Gabriela G. SOST Inhibits Prostate Cancer Invasion. Plos One. 10(11):e0142058. PubMed |
| Ek, Sara; Andréasson, Ulrika; Hober, Sophia; Kampf, Caroline; Pontén, Fredrik; Uhlén, Mathias; Merz, Hartmut; Borrebaeck, Carl A K. From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies. Molecular & Cellular Proteomics : Mcp. 2006;5(6):1072-81. PubMed |
| Nyström, Jenny; Hultenby, Kjell; Ek, Sara; Sjölund, Jonas; Axelson, Håkan; Jirström, Karin; Saleem, Moin A; Nilsson, Kristina; Johansson, Martin E. CRIM1 is localized to the podocyte filtration slit diaphragm of the adult human kidney. Nephrology, Dialysis, Transplantation : Official Publication Of The European Dialysis And Transplant Association - European Renal Association. 2009;24(7):2038-44. PubMed |
| Chiu, Han Sheng; York, J Philippe; Wilkinson, Lorine; Zhang, Pumin; Little, Melissa H; Pennisi, David J. Production of a mouse line with a conditional Crim1 mutant allele. Genesis (New York, N.y. : 2000). 2012;50(9):711-6. PubMed |


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LTEYEAGVCEDENWTDDQLLGFKPCNENLIAGCNIINGKCECNTIRTCSNPFEFPSQDMCLSALKRIEEEKPDCSKARCEVQFSPRCPEDSVLIEGYAPPGECCPLP |
| Gene Sequence | LTEYEAGVCEDENWTDDQLLGFKPCNENLIAGCNIINGKCECNTIRTCSNPFEFPSQDMCLSALKRIEEEKPDCSKARCEVQFSPRCPEDSVLIEGYAPPGECCPLP |
| Gene ID - Mouse | ENSMUSG00000024074 |
| Gene ID - Rat | ENSRNOG00000004208 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CRIM1 pAb (ATL-HPA000556 w/enhanced validation) | |
| Datasheet | Anti CRIM1 pAb (ATL-HPA000556 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CRIM1 pAb (ATL-HPA000556 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CRIM1 pAb (ATL-HPA000556 w/enhanced validation) | |
| Datasheet | Anti CRIM1 pAb (ATL-HPA000556 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CRIM1 pAb (ATL-HPA000556 w/enhanced validation) |
| Citations for Anti CRIM1 pAb (ATL-HPA000556 w/enhanced validation) – 4 Found |
| Hudson, Bryan D; Hum, Nicholas R; Thomas, Cynthia B; Kohlgruber, Ayano; Sebastian, Aimy; Collette, Nicole M; Coleman, Matthew A; Christiansen, Blaine A; Loots, Gabriela G. SOST Inhibits Prostate Cancer Invasion. Plos One. 10(11):e0142058. PubMed |
| Ek, Sara; Andréasson, Ulrika; Hober, Sophia; Kampf, Caroline; Pontén, Fredrik; Uhlén, Mathias; Merz, Hartmut; Borrebaeck, Carl A K. From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies. Molecular & Cellular Proteomics : Mcp. 2006;5(6):1072-81. PubMed |
| Nyström, Jenny; Hultenby, Kjell; Ek, Sara; Sjölund, Jonas; Axelson, Håkan; Jirström, Karin; Saleem, Moin A; Nilsson, Kristina; Johansson, Martin E. CRIM1 is localized to the podocyte filtration slit diaphragm of the adult human kidney. Nephrology, Dialysis, Transplantation : Official Publication Of The European Dialysis And Transplant Association - European Renal Association. 2009;24(7):2038-44. PubMed |
| Chiu, Han Sheng; York, J Philippe; Wilkinson, Lorine; Zhang, Pumin; Little, Melissa H; Pennisi, David J. Production of a mouse line with a conditional Crim1 mutant allele. Genesis (New York, N.y. : 2000). 2012;50(9):711-6. PubMed |