Related products

No related products found

Try browsing our complete catalog of products.

Reviews 0

No reviews have been added for this product.

Reviews

Protein Description: crystallin, lambda 1
Gene Name: CRYL1
Alternative Gene Name: GDH, lambda-CRY, MGC149525, MGC149526
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021947: 83%, ENSRNOG00000008989: 81%
Entrez Gene ID: 51084
Uniprot ID: Q9Y2S2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application	ICC, IHC
Reactivity	Human
Clonality	Polyclonal
Host	Rabbit
Immunogen	IRNALENIRKEMKLLEQAGSLKGSLSVEEQLSLISGCPNIQEAVEGAMHIQECVPEDLELKKKIFAQLDSIIDDRVILSSSTSCLM
Gene Sequence	IRNALENIRKEMKLLEQAGSLKGSLSVEEQLSLISGCPNIQEAVEGAMHIQECVPEDLELKKKIFAQLDSIIDDRVILSSSTSCLM
Gene ID - Mouse	ENSMUSG00000021947
Gene ID - Rat	ENSRNOG00000008989
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CRYL1 pAb (ATL-HPA040403 w/enhanced validation)
Datasheet	Anti CRYL1 pAb (ATL-HPA040403 w/enhanced validation) Datasheet (External Link)
Vendor Page	Anti CRYL1 pAb (ATL-HPA040403 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CRYL1 pAb (ATL-HPA040403 w/enhanced validation)
Datasheet	Anti CRYL1 pAb (ATL-HPA040403 w/enhanced validation) Datasheet (External Link)
Vendor Page	Anti CRYL1 pAb (ATL-HPA040403 w/enhanced validation)

Citations for Anti CRYL1 pAb (ATL-HPA040403 w/enhanced validation) – 1 Found

Garzón, Ingrid; Chato-Astrain, Jesus; González-Gallardo, Carmen; Ionescu, Ana; Cardona, Juan de la Cruz; Mateu, Miguel; Carda, Carmen; Pérez, María Del Mar; Martín-Piedra, Miguel Ángel; Alaminos, Miguel. Long-Term in vivo Evaluation of Orthotypical and Heterotypical Bioengineered Human Corneas. Frontiers In Bioengineering And Biotechnology. 8( 32671048):681. PubMed

No related products found

Reviews 0

Reviews

Anti CRYL1 pAb (ATL-HPA040403 w/enhanced validation)

Additional information

Anti CRYL1 pAb (ATL-HPA040403 w/enhanced validation)

Additional information

Specifications

No related products found

Reviews 0

Anti CRYL1 pAb (ATL-HPA040403 w/enhanced validation)

Additional information

Specifications

Anti CRYL1 pAb (ATL-HPA040403 w/enhanced validation)

Additional information

Specifications

Specifications