Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NFDVFLQHNNTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAYLNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQP |
| Gene Sequence | NFDVFLQHNNTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAYLNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQP |
| Gene ID - Mouse | ENSMUSG00000024621 |
| Gene ID - Rat | ENSRNOG00000018414 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CSF1R pAb (ATL-HPA012323) | |
| Datasheet | Anti CSF1R pAb (ATL-HPA012323) Datasheet (External Link) |
| Vendor Page | Anti CSF1R pAb (ATL-HPA012323) at Atlas Antibodies |
| Documents & Links for Anti CSF1R pAb (ATL-HPA012323) | |
| Datasheet | Anti CSF1R pAb (ATL-HPA012323) Datasheet (External Link) |
| Vendor Page | Anti CSF1R pAb (ATL-HPA012323) |
| Citations for Anti CSF1R pAb (ATL-HPA012323) – 4 Found |
| Pass, Harvey I; Lavilla, Carmencita; Canino, Claudia; Goparaju, Chandra; Preiss, Jordan; Noreen, Samrah; Blandino, Giovanni; Cioce, Mario. Inhibition of the colony-stimulating-factor-1 receptor affects the resistance of lung cancer cells to cisplatin. Oncotarget. 2016;7(35):56408-56421. PubMed |
| Baghdadi, Muhammad; Endo, Hiraku; Takano, Atsushi; Ishikawa, Kozo; Kameda, Yosuke; Wada, Haruka; Miyagi, Yohei; Yokose, Tomoyuki; Ito, Hiroyuki; Nakayama, Haruhiko; Daigo, Yataro; Suzuki, Nao; Seino, Ken-Ichiro. High co-expression of IL-34 and M-CSF correlates with tumor progression and poor survival in lung cancers. Scientific Reports. 2018;8(1):418. PubMed |
| Wang, Xingchao; Zhang, Jianfeng; Hu, Baoying; Qian, Fei. High Expression of CSF-1R Predicts Poor Prognosis and CSF-1R(high) Tumor-Associated Macrophages Inhibit Anti-Tumor Immunity in Colon Adenocarcinoma. Frontiers In Oncology. 12( 35444953):850767. PubMed |
| Shi, Xiaolong; Kaller, Markus; Rokavec, Matjaz; Kirchner, Thomas; Horst, David; Hermeking, Heiko. Characterization of a p53/miR-34a/CSF1R/STAT3 Feedback Loop in Colorectal Cancer. Cellular And Molecular Gastroenterology And Hepatology. 10(2):391-418. PubMed |
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NFDVFLQHNNTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAYLNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQP |
| Gene Sequence | NFDVFLQHNNTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAYLNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQP |
| Gene ID - Mouse | ENSMUSG00000024621 |
| Gene ID - Rat | ENSRNOG00000018414 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CSF1R pAb (ATL-HPA012323) | |
| Datasheet | Anti CSF1R pAb (ATL-HPA012323) Datasheet (External Link) |
| Vendor Page | Anti CSF1R pAb (ATL-HPA012323) at Atlas Antibodies |
| Documents & Links for Anti CSF1R pAb (ATL-HPA012323) | |
| Datasheet | Anti CSF1R pAb (ATL-HPA012323) Datasheet (External Link) |
| Vendor Page | Anti CSF1R pAb (ATL-HPA012323) |
| Citations for Anti CSF1R pAb (ATL-HPA012323) – 4 Found |
| Pass, Harvey I; Lavilla, Carmencita; Canino, Claudia; Goparaju, Chandra; Preiss, Jordan; Noreen, Samrah; Blandino, Giovanni; Cioce, Mario. Inhibition of the colony-stimulating-factor-1 receptor affects the resistance of lung cancer cells to cisplatin. Oncotarget. 2016;7(35):56408-56421. PubMed |
| Baghdadi, Muhammad; Endo, Hiraku; Takano, Atsushi; Ishikawa, Kozo; Kameda, Yosuke; Wada, Haruka; Miyagi, Yohei; Yokose, Tomoyuki; Ito, Hiroyuki; Nakayama, Haruhiko; Daigo, Yataro; Suzuki, Nao; Seino, Ken-Ichiro. High co-expression of IL-34 and M-CSF correlates with tumor progression and poor survival in lung cancers. Scientific Reports. 2018;8(1):418. PubMed |
| Wang, Xingchao; Zhang, Jianfeng; Hu, Baoying; Qian, Fei. High Expression of CSF-1R Predicts Poor Prognosis and CSF-1R(high) Tumor-Associated Macrophages Inhibit Anti-Tumor Immunity in Colon Adenocarcinoma. Frontiers In Oncology. 12( 35444953):850767. PubMed |
| Shi, Xiaolong; Kaller, Markus; Rokavec, Matjaz; Kirchner, Thomas; Horst, David; Hermeking, Heiko. Characterization of a p53/miR-34a/CSF1R/STAT3 Feedback Loop in Colorectal Cancer. Cellular And Molecular Gastroenterology And Hepatology. 10(2):391-418. PubMed |