Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELT |
| Gene Sequence | QVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELT |
| Gene ID - Mouse | ENSMUSG00000005054 |
| Gene ID - Rat | ENSRNOG00000001201 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CSTB pAb (ATL-HPA017380 w/enhanced validation) | |
| Datasheet | Anti CSTB pAb (ATL-HPA017380 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CSTB pAb (ATL-HPA017380 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CSTB pAb (ATL-HPA017380 w/enhanced validation) | |
| Datasheet | Anti CSTB pAb (ATL-HPA017380 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CSTB pAb (ATL-HPA017380 w/enhanced validation) |
| Citations for Anti CSTB pAb (ATL-HPA017380 w/enhanced validation) – 3 Found |
| Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |
| Santana-Rivera, Yasmarie; Rabelo-Fernández, Robert J; Quiñones-Díaz, Blanca I; Grafals-Ruíz, Nilmary; Santiago-Sánchez, Ginette; Lozada-Delgado, Eunice L; Echevarría-Vargas, Ileabett M; Apiz, Juan; Soto, Daniel; Rosado, Andrea; Meléndez, Loyda; Valiyeva, Fatima; Vivas-Mejía, Pablo E. Reduced expression of enolase-1 correlates with high intracellular glucose levels and increased senescence in cisplatin-resistant ovarian cancer cells. American Journal Of Translational Research. 12(4):1275-1292. PubMed |
| Lucchino, Valeria; Scaramuzzino, Luana; Scalise, Stefania; Lo Conte, Michela; Zannino, Clara; Benedetto, Giorgia Lucia; Aguglia, Umberto; Ferlazzo, Edoardo; Cuda, Giovanni; Parrotta, Elvira Immacolata. Insights into the Genetic Profile of Two Siblings Affected by Unverricht-Lundborg Disease Using Patient-Derived hiPSCs. Cells. 2022;11(21) PubMed |
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELT |
| Gene Sequence | QVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELT |
| Gene ID - Mouse | ENSMUSG00000005054 |
| Gene ID - Rat | ENSRNOG00000001201 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CSTB pAb (ATL-HPA017380 w/enhanced validation) | |
| Datasheet | Anti CSTB pAb (ATL-HPA017380 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CSTB pAb (ATL-HPA017380 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CSTB pAb (ATL-HPA017380 w/enhanced validation) | |
| Datasheet | Anti CSTB pAb (ATL-HPA017380 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CSTB pAb (ATL-HPA017380 w/enhanced validation) |
| Citations for Anti CSTB pAb (ATL-HPA017380 w/enhanced validation) – 3 Found |
| Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |
| Santana-Rivera, Yasmarie; Rabelo-Fernández, Robert J; Quiñones-Díaz, Blanca I; Grafals-Ruíz, Nilmary; Santiago-Sánchez, Ginette; Lozada-Delgado, Eunice L; Echevarría-Vargas, Ileabett M; Apiz, Juan; Soto, Daniel; Rosado, Andrea; Meléndez, Loyda; Valiyeva, Fatima; Vivas-Mejía, Pablo E. Reduced expression of enolase-1 correlates with high intracellular glucose levels and increased senescence in cisplatin-resistant ovarian cancer cells. American Journal Of Translational Research. 12(4):1275-1292. PubMed |
| Lucchino, Valeria; Scaramuzzino, Luana; Scalise, Stefania; Lo Conte, Michela; Zannino, Clara; Benedetto, Giorgia Lucia; Aguglia, Umberto; Ferlazzo, Edoardo; Cuda, Giovanni; Parrotta, Elvira Immacolata. Insights into the Genetic Profile of Two Siblings Affected by Unverricht-Lundborg Disease Using Patient-Derived hiPSCs. Cells. 2022;11(21) PubMed |