Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
![Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human cell line A-431](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/40951/16964/atl-hpa000922_anti-ctage5-pab-atl-hpa000922_27549__75653.1783622129.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EKEATEAQSLEATCEKLNRSNSELEDEILCLEKELKEEKSKHSEQDELMADISKRIQSLEDESKSLKSQVAEAKMTFKIFQMNEERLKIAIKDALNENSQLQESQKQLLQ |
| Gene Sequence | EKEATEAQSLEATCEKLNRSNSELEDEILCLEKELKEEKSKHSEQDELMADISKRIQSLEDESKSLKSQVAEAKMTFKIFQMNEERLKIAIKDALNENSQLQESQKQLLQ |
| Gene ID - Mouse | ENSMUSG00000021000 |
| Gene ID - Rat | ENSRNOG00000005101 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CTAGE5 pAb (ATL-HPA000922) | |
| Datasheet | Anti CTAGE5 pAb (ATL-HPA000922) Datasheet (External Link) |
| Vendor Page | Anti CTAGE5 pAb (ATL-HPA000922) at Atlas Antibodies |
| Documents & Links for Anti CTAGE5 pAb (ATL-HPA000922) | |
| Datasheet | Anti CTAGE5 pAb (ATL-HPA000922) Datasheet (External Link) |
| Vendor Page | Anti CTAGE5 pAb (ATL-HPA000922) |
| Citations for Anti CTAGE5 pAb (ATL-HPA000922) – 1 Found |
| Ek, Sara; Andréasson, Ulrika; Hober, Sophia; Kampf, Caroline; Pontén, Fredrik; Uhlén, Mathias; Merz, Hartmut; Borrebaeck, Carl A K. From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies. Molecular & Cellular Proteomics : Mcp. 2006;5(6):1072-81. PubMed |
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EKEATEAQSLEATCEKLNRSNSELEDEILCLEKELKEEKSKHSEQDELMADISKRIQSLEDESKSLKSQVAEAKMTFKIFQMNEERLKIAIKDALNENSQLQESQKQLLQ |
| Gene Sequence | EKEATEAQSLEATCEKLNRSNSELEDEILCLEKELKEEKSKHSEQDELMADISKRIQSLEDESKSLKSQVAEAKMTFKIFQMNEERLKIAIKDALNENSQLQESQKQLLQ |
| Gene ID - Mouse | ENSMUSG00000021000 |
| Gene ID - Rat | ENSRNOG00000005101 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CTAGE5 pAb (ATL-HPA000922) | |
| Datasheet | Anti CTAGE5 pAb (ATL-HPA000922) Datasheet (External Link) |
| Vendor Page | Anti CTAGE5 pAb (ATL-HPA000922) at Atlas Antibodies |
| Documents & Links for Anti CTAGE5 pAb (ATL-HPA000922) | |
| Datasheet | Anti CTAGE5 pAb (ATL-HPA000922) Datasheet (External Link) |
| Vendor Page | Anti CTAGE5 pAb (ATL-HPA000922) |
| Citations for Anti CTAGE5 pAb (ATL-HPA000922) – 1 Found |
| Ek, Sara; Andréasson, Ulrika; Hober, Sophia; Kampf, Caroline; Pontén, Fredrik; Uhlén, Mathias; Merz, Hartmut; Borrebaeck, Carl A K. From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies. Molecular & Cellular Proteomics : Mcp. 2006;5(6):1072-81. PubMed |