Related products

No related products found

Try browsing our complete catalog of products.

Reviews 0

No reviews have been added for this product.

Reviews

Protein Description: CBP80/20-dependent translation initiation factor
Gene Name: CTIF
Alternative Gene Name: KIAA0427
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052928: 96%, ENSRNOG00000018342: 94%
Entrez Gene ID: 9811
Uniprot ID: O43310
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application	WB, ICC, IHC
Reactivity	Human
Clonality	Polyclonal
Host	Rabbit
Immunogen	TFDSFSGATWDLQPEKLDFTQFHRKVRHTPKQPLPHIDREGCGKGKLEDGDGINLNDIEKVLPAWQGYHPMPHEVEIAHTKKLFR
Gene Sequence	TFDSFSGATWDLQPEKLDFTQFHRKVRHTPKQPLPHIDREGCGKGKLEDGDGINLNDIEKVLPAWQGYHPMPHEVEIAHTKKLFR
Gene ID - Mouse	ENSMUSG00000052928
Gene ID - Rat	ENSRNOG00000018342
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CTIF pAb (ATL-HPA016865)
Datasheet	Anti CTIF pAb (ATL-HPA016865) Datasheet (External Link)
Vendor Page	Anti CTIF pAb (ATL-HPA016865) at Atlas Antibodies

Documents & Links for Anti CTIF pAb (ATL-HPA016865)
Datasheet	Anti CTIF pAb (ATL-HPA016865) Datasheet (External Link)
Vendor Page	Anti CTIF pAb (ATL-HPA016865)

Citations for Anti CTIF pAb (ATL-HPA016865) – 1 Found

Dankert, John F; Pagan, Julia K; Starostina, Natalia G; Kipreos, Edward T; Pagano, Michele. FEM1 proteins are ancient regulators of SLBP degradation. Cell Cycle (Georgetown, Tex.). 2017;16(6):556-564. PubMed

No related products found

Reviews 0

Reviews

Anti CTIF pAb (ATL-HPA016865)

Additional information

Anti CTIF pAb (ATL-HPA016865)

Additional information

Specifications

No related products found

Reviews 0

Anti CTIF pAb (ATL-HPA016865)

Additional information

Specifications

Anti CTIF pAb (ATL-HPA016865)

Additional information

Specifications

Specifications