Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/53770/40622/atl-hpa046119_anti-ctnna1-pab-atl-hpa046119_51880__08674.1783639198.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LADMADVYKLLVQLKVVEDGILKLRNAGNEQDLGIQYKALKPEVDKLNIMAAK |
| Gene Sequence | LADMADVYKLLVQLKVVEDGILKLRNAGNEQDLGIQYKALKPEVDKLNIMAAK |
| Gene ID - Mouse | ENSMUSG00000037815 |
| Gene ID - Rat | ENSRNOG00000005796 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CTNNA1 pAb (ATL-HPA046119) | |
| Datasheet | Anti CTNNA1 pAb (ATL-HPA046119) Datasheet (External Link) |
| Vendor Page | Anti CTNNA1 pAb (ATL-HPA046119) at Atlas Antibodies |
| Documents & Links for Anti CTNNA1 pAb (ATL-HPA046119) | |
| Datasheet | Anti CTNNA1 pAb (ATL-HPA046119) Datasheet (External Link) |
| Vendor Page | Anti CTNNA1 pAb (ATL-HPA046119) |
| Citations for Anti CTNNA1 pAb (ATL-HPA046119) – 1 Found |
| Duś-Szachniewicz, Kamila; Drobczyński, Sławomir; Ziółkowski, Piotr; Kołodziej, Paweł; Walaszek, Kinga M; Korzeniewska, Aleksandra K; Agrawal, Anil; Kupczyk, Piotr; Woźniak, Marta. Physiological Hypoxia (Physioxia) Impairs the Early Adhesion of Single Lymphoma Cell to Marrow Stromal Cell and Extracellular Matrix. Optical Tweezers Study. International Journal Of Molecular Sciences. 2018;19(7) PubMed |
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LADMADVYKLLVQLKVVEDGILKLRNAGNEQDLGIQYKALKPEVDKLNIMAAK |
| Gene Sequence | LADMADVYKLLVQLKVVEDGILKLRNAGNEQDLGIQYKALKPEVDKLNIMAAK |
| Gene ID - Mouse | ENSMUSG00000037815 |
| Gene ID - Rat | ENSRNOG00000005796 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CTNNA1 pAb (ATL-HPA046119) | |
| Datasheet | Anti CTNNA1 pAb (ATL-HPA046119) Datasheet (External Link) |
| Vendor Page | Anti CTNNA1 pAb (ATL-HPA046119) at Atlas Antibodies |
| Documents & Links for Anti CTNNA1 pAb (ATL-HPA046119) | |
| Datasheet | Anti CTNNA1 pAb (ATL-HPA046119) Datasheet (External Link) |
| Vendor Page | Anti CTNNA1 pAb (ATL-HPA046119) |
| Citations for Anti CTNNA1 pAb (ATL-HPA046119) – 1 Found |
| Duś-Szachniewicz, Kamila; Drobczyński, Sławomir; Ziółkowski, Piotr; Kołodziej, Paweł; Walaszek, Kinga M; Korzeniewska, Aleksandra K; Agrawal, Anil; Kupczyk, Piotr; Woźniak, Marta. Physiological Hypoxia (Physioxia) Impairs the Early Adhesion of Single Lymphoma Cell to Marrow Stromal Cell and Extracellular Matrix. Optical Tweezers Study. International Journal Of Molecular Sciences. 2018;19(7) PubMed |