Loading...
Loading...
Loading...
Loading...
Atlas Antibodies






| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAH |
| Gene Sequence | SYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAH |
| Gene ID - Mouse | ENSMUSG00000006932 |
| Gene ID - Rat | ENSRNOG00000054172 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CTNNB1 pAb (ATL-HPA029159 w/enhanced validation) | |
| Datasheet | Anti CTNNB1 pAb (ATL-HPA029159 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CTNNB1 pAb (ATL-HPA029159 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CTNNB1 pAb (ATL-HPA029159 w/enhanced validation) | |
| Datasheet | Anti CTNNB1 pAb (ATL-HPA029159 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CTNNB1 pAb (ATL-HPA029159 w/enhanced validation) |
| Citations for Anti CTNNB1 pAb (ATL-HPA029159 w/enhanced validation) – 4 Found |
| Albanese, Isabella; Daskalopoulou, Stella S; Yu, Bin; You, Zhipeng; Genest, Jacques; Alsheikh-Ali, Alawi; Schwertani, Adel G. The Urotensin II System and Carotid Atherosclerosis: A Role in Vascular Calcification. Frontiers In Pharmacology. 7( 27375483):149. PubMed |
| Klein, Donna; Goldberg, Shalom; Theile, Christopher S; Dambra, Richard; Haskell, Kathleen; Kuhar, Elise; Lin, Tricia; Parmar, Rubina; Manoharan, Muthiah; Richter, Mark; Wu, Meizhen; Mendrola Zarazowski, Jeannine; Jadhav, Vasant; Maier, Martin A; Sepp-Lorenzino, Laura; O'Neil, Karyn; Dudkin, Vadim. Centyrin ligands for extrahepatic delivery of siRNA. Molecular Therapy : The Journal Of The American Society Of Gene Therapy. 2021;29(6):2053-2066. PubMed |
| Tian, Bing; Widen, Steven G; Yang, Jun; Wood, Thomas G; Kudlicki, Andrzej; Zhao, Yingxin; Brasier, Allan R. The NFκB subunit RELA is a master transcriptional regulator of the committed epithelial-mesenchymal transition in airway epithelial cells. The Journal Of Biological Chemistry. 2018;293(42):16528-16545. PubMed |
| Khan, Kashif; Yu, Bin; Kiwan, Chrystina; Shalal, Yousif; Filimon, Sabin; Cipro, Megan; Shum-Tim, Dominique; Cecere, Renzo; Schwertani, Adel. The Role of Wnt/β-Catenin Pathway Mediators in Aortic Valve Stenosis. Frontiers In Cell And Developmental Biology. 8( 33015048):862. PubMed |
No reviews have been added for this product.
Try browsing our complete catalog of products.
Atlas Antibodies






| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAH |
| Gene Sequence | SYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAH |
| Gene ID - Mouse | ENSMUSG00000006932 |
| Gene ID - Rat | ENSRNOG00000054172 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CTNNB1 pAb (ATL-HPA029159 w/enhanced validation) | |
| Datasheet | Anti CTNNB1 pAb (ATL-HPA029159 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CTNNB1 pAb (ATL-HPA029159 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CTNNB1 pAb (ATL-HPA029159 w/enhanced validation) | |
| Datasheet | Anti CTNNB1 pAb (ATL-HPA029159 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CTNNB1 pAb (ATL-HPA029159 w/enhanced validation) |
| Citations for Anti CTNNB1 pAb (ATL-HPA029159 w/enhanced validation) – 4 Found |
| Albanese, Isabella; Daskalopoulou, Stella S; Yu, Bin; You, Zhipeng; Genest, Jacques; Alsheikh-Ali, Alawi; Schwertani, Adel G. The Urotensin II System and Carotid Atherosclerosis: A Role in Vascular Calcification. Frontiers In Pharmacology. 7( 27375483):149. PubMed |
| Klein, Donna; Goldberg, Shalom; Theile, Christopher S; Dambra, Richard; Haskell, Kathleen; Kuhar, Elise; Lin, Tricia; Parmar, Rubina; Manoharan, Muthiah; Richter, Mark; Wu, Meizhen; Mendrola Zarazowski, Jeannine; Jadhav, Vasant; Maier, Martin A; Sepp-Lorenzino, Laura; O'Neil, Karyn; Dudkin, Vadim. Centyrin ligands for extrahepatic delivery of siRNA. Molecular Therapy : The Journal Of The American Society Of Gene Therapy. 2021;29(6):2053-2066. PubMed |
| Tian, Bing; Widen, Steven G; Yang, Jun; Wood, Thomas G; Kudlicki, Andrzej; Zhao, Yingxin; Brasier, Allan R. The NFκB subunit RELA is a master transcriptional regulator of the committed epithelial-mesenchymal transition in airway epithelial cells. The Journal Of Biological Chemistry. 2018;293(42):16528-16545. PubMed |
| Khan, Kashif; Yu, Bin; Kiwan, Chrystina; Shalal, Yousif; Filimon, Sabin; Cipro, Megan; Shum-Tim, Dominique; Cecere, Renzo; Schwertani, Adel. The Role of Wnt/β-Catenin Pathway Mediators in Aortic Valve Stenosis. Frontiers In Cell And Developmental Biology. 8( 33015048):862. PubMed |