Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGT |
| Gene Sequence | LWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGT |
| Gene ID - Mouse | ENSMUSG00000007891 |
| Gene ID - Rat | ENSRNOG00000020206 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CTSD pAb (ATL-HPA003001) | |
| Datasheet | Anti CTSD pAb (ATL-HPA003001) Datasheet (External Link) |
| Vendor Page | Anti CTSD pAb (ATL-HPA003001) at Atlas Antibodies |
| Documents & Links for Anti CTSD pAb (ATL-HPA003001) | |
| Datasheet | Anti CTSD pAb (ATL-HPA003001) Datasheet (External Link) |
| Vendor Page | Anti CTSD pAb (ATL-HPA003001) |
| Citations for Anti CTSD pAb (ATL-HPA003001) – 2 Found |
| Piras, Antonio; Collin, Ludovic; Grüninger, Fiona; Graff, Caroline; Rönnbäck, Annica. Autophagic and lysosomal defects in human tauopathies: analysis of post-mortem brain from patients with familial Alzheimer disease, corticobasal degeneration and progressive supranuclear palsy. Acta Neuropathologica Communications. 2016;4( 26936765):22. PubMed |
| Ahmad, Yasmeen; Boisvert, Francois-Michel; Lundberg, Emma; Uhlen, Mathias; Lamond, Angus I. Systematic analysis of protein pools, isoforms, and modifications affecting turnover and subcellular localization. Molecular & Cellular Proteomics : Mcp. 2012;11(3):M111.013680. PubMed |
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGT |
| Gene Sequence | LWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGT |
| Gene ID - Mouse | ENSMUSG00000007891 |
| Gene ID - Rat | ENSRNOG00000020206 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CTSD pAb (ATL-HPA003001) | |
| Datasheet | Anti CTSD pAb (ATL-HPA003001) Datasheet (External Link) |
| Vendor Page | Anti CTSD pAb (ATL-HPA003001) at Atlas Antibodies |
| Documents & Links for Anti CTSD pAb (ATL-HPA003001) | |
| Datasheet | Anti CTSD pAb (ATL-HPA003001) Datasheet (External Link) |
| Vendor Page | Anti CTSD pAb (ATL-HPA003001) |
| Citations for Anti CTSD pAb (ATL-HPA003001) – 2 Found |
| Piras, Antonio; Collin, Ludovic; Grüninger, Fiona; Graff, Caroline; Rönnbäck, Annica. Autophagic and lysosomal defects in human tauopathies: analysis of post-mortem brain from patients with familial Alzheimer disease, corticobasal degeneration and progressive supranuclear palsy. Acta Neuropathologica Communications. 2016;4( 26936765):22. PubMed |
| Ahmad, Yasmeen; Boisvert, Francois-Michel; Lundberg, Emma; Uhlen, Mathias; Lamond, Angus I. Systematic analysis of protein pools, isoforms, and modifications affecting turnover and subcellular localization. Molecular & Cellular Proteomics : Mcp. 2012;11(3):M111.013680. PubMed |