Related products

No related products found

Try browsing our complete catalog of products.

Reviews 0

No reviews have been added for this product.

Reviews

Protein Description: cullin 7
Gene Name: CUL7
Alternative Gene Name: dJ20C7.5, KIAA0076
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038545: 51%, ENSRNOG00000017857: 60%
Entrez Gene ID: 9820
Uniprot ID: Q14999
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application	IHC
Reactivity	Human
Clonality	Polyclonal
Host	Rabbit
Immunogen	FFIKKLDGPDHQEVLQILQENLDGEILDDEILAELAVPIELAQDLLLTLPQRLNDSALRDLINCHVYKKYGPEALAGNQAYPSLLEAQEDV
Gene Sequence	FFIKKLDGPDHQEVLQILQENLDGEILDDEILAELAVPIELAQDLLLTLPQRLNDSALRDLINCHVYKKYGPEALAGNQAYPSLLEAQEDV
Gene ID - Mouse	ENSMUSG00000038545
Gene ID - Rat	ENSRNOG00000017857
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CUL7 pAb (ATL-HPA030095)
Datasheet	Anti CUL7 pAb (ATL-HPA030095) Datasheet (External Link)
Vendor Page	Anti CUL7 pAb (ATL-HPA030095) at Atlas Antibodies

Documents & Links for Anti CUL7 pAb (ATL-HPA030095)
Datasheet	Anti CUL7 pAb (ATL-HPA030095) Datasheet (External Link)
Vendor Page	Anti CUL7 pAb (ATL-HPA030095)

Citations for Anti CUL7 pAb (ATL-HPA030095) – 1 Found

Blondelle, Jordan; Biju, Andrea; Lange, Stephan. The Role of Cullin-RING Ligases in Striated Muscle Development, Function, and Disease. International Journal Of Molecular Sciences. 2020;21(21) PubMed

No related products found

Reviews 0

Reviews

Anti CUL7 pAb (ATL-HPA030095)

Additional information

Specifications

Reviews 0

Anti CUL7 pAb (ATL-HPA030095)

Additional information

Specifications

No related products found

Anti CUL7 pAb (ATL-HPA030095)

Additional information

Anti CUL7 pAb (ATL-HPA030095)

Additional information

Specifications

Specifications