Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | CKAEHILLWMSKDEIYANCHKMLGEDGQVIGPSQESAGEVGALDKSVLEEMETDVKSLIQRALRQLEECVGTIPPAPLLHTVH |
| Gene Sequence | CKAEHILLWMSKDEIYANCHKMLGEDGQVIGPSQESAGEVGALDKSVLEEMETDVKSLIQRALRQLEECVGTIPPAPLLHTVH |
| Gene ID - Mouse | ENSMUSG00000038545 |
| Gene ID - Rat | ENSRNOG00000017857 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CUL7 pAb (ATL-HPA030096) | |
| Datasheet | Anti CUL7 pAb (ATL-HPA030096) Datasheet (External Link) |
| Vendor Page | Anti CUL7 pAb (ATL-HPA030096) at Atlas Antibodies |
| Documents & Links for Anti CUL7 pAb (ATL-HPA030096) | |
| Datasheet | Anti CUL7 pAb (ATL-HPA030096) Datasheet (External Link) |
| Vendor Page | Anti CUL7 pAb (ATL-HPA030096) |
| Citations for Anti CUL7 pAb (ATL-HPA030096) – 1 Found |
| Fahlbusch, Fabian B; Dawood, Yousif; Hartner, Andrea; Menendez-Castro, Carlos; Nögel, Stephanie C; Tzschoppe, Anja; Schneider, Holm; Strissel, Pamela; Beckmann, Matthias W; Schleussner, Ekkehard; Ruebner, Matthias; Dörr, Helmuth G; Schild, Ralf L; Rascher, Wolfgang; Dötsch, Jörg. Cullin 7 and Fbxw 8 expression in trophoblastic cells is regulated via oxygen tension: implications for intrauterine growth restriction?. The Journal Of Maternal-Fetal & Neonatal Medicine : The Official Journal Of The European Association Of Perinatal Medicine, The Federation Of Asia And Oceania Perinatal Societies, The International Society Of Perinatal Obstetricians. 2012;25(11):2209-15. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | CKAEHILLWMSKDEIYANCHKMLGEDGQVIGPSQESAGEVGALDKSVLEEMETDVKSLIQRALRQLEECVGTIPPAPLLHTVH |
| Gene Sequence | CKAEHILLWMSKDEIYANCHKMLGEDGQVIGPSQESAGEVGALDKSVLEEMETDVKSLIQRALRQLEECVGTIPPAPLLHTVH |
| Gene ID - Mouse | ENSMUSG00000038545 |
| Gene ID - Rat | ENSRNOG00000017857 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CUL7 pAb (ATL-HPA030096) | |
| Datasheet | Anti CUL7 pAb (ATL-HPA030096) Datasheet (External Link) |
| Vendor Page | Anti CUL7 pAb (ATL-HPA030096) at Atlas Antibodies |
| Documents & Links for Anti CUL7 pAb (ATL-HPA030096) | |
| Datasheet | Anti CUL7 pAb (ATL-HPA030096) Datasheet (External Link) |
| Vendor Page | Anti CUL7 pAb (ATL-HPA030096) |
| Citations for Anti CUL7 pAb (ATL-HPA030096) – 1 Found |
| Fahlbusch, Fabian B; Dawood, Yousif; Hartner, Andrea; Menendez-Castro, Carlos; Nögel, Stephanie C; Tzschoppe, Anja; Schneider, Holm; Strissel, Pamela; Beckmann, Matthias W; Schleussner, Ekkehard; Ruebner, Matthias; Dörr, Helmuth G; Schild, Ralf L; Rascher, Wolfgang; Dötsch, Jörg. Cullin 7 and Fbxw 8 expression in trophoblastic cells is regulated via oxygen tension: implications for intrauterine growth restriction?. The Journal Of Maternal-Fetal & Neonatal Medicine : The Official Journal Of The European Association Of Perinatal Medicine, The Federation Of Asia And Oceania Perinatal Societies, The International Society Of Perinatal Obstetricians. 2012;25(11):2209-15. PubMed |