Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGGMDESVVLE |
| Gene Sequence | GVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGGMDESVVLE |
| Gene ID - Mouse | ENSMUSG00000031778 |
| Gene ID - Rat | ENSRNOG00000016326 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CX3CL1 pAb (ATL-HPA040361) | |
| Datasheet | Anti CX3CL1 pAb (ATL-HPA040361) Datasheet (External Link) |
| Vendor Page | Anti CX3CL1 pAb (ATL-HPA040361) at Atlas Antibodies |
| Documents & Links for Anti CX3CL1 pAb (ATL-HPA040361) | |
| Datasheet | Anti CX3CL1 pAb (ATL-HPA040361) Datasheet (External Link) |
| Vendor Page | Anti CX3CL1 pAb (ATL-HPA040361) |
| Citations for Anti CX3CL1 pAb (ATL-HPA040361) – 2 Found |
| Zsiros, Emese; Duttagupta, Priyanka; Dangaj, Denarda; Li, Hongzhe; Frank, Renee; Garrabrant, Thomas; Hagemann, Ian S; Levine, Bruce L; June, Carl H; Zhang, Lin; Wang, Ena; Marincola, Francesco M; Bedognetti, Davide; Powell, Daniel J Jr; Tanyi, Janos; Feldman, Michael D; Kandalaft, Lana E; Coukos, George. The Ovarian Cancer Chemokine Landscape Is Conducive to Homing of Vaccine-Primed and CD3/CD28-Costimulated T Cells Prepared for Adoptive Therapy. Clinical Cancer Research : An Official Journal Of The American Association For Cancer Research. 2015;21(12):2840-50. PubMed |
| Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGGMDESVVLE |
| Gene Sequence | GVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGGMDESVVLE |
| Gene ID - Mouse | ENSMUSG00000031778 |
| Gene ID - Rat | ENSRNOG00000016326 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CX3CL1 pAb (ATL-HPA040361) | |
| Datasheet | Anti CX3CL1 pAb (ATL-HPA040361) Datasheet (External Link) |
| Vendor Page | Anti CX3CL1 pAb (ATL-HPA040361) at Atlas Antibodies |
| Documents & Links for Anti CX3CL1 pAb (ATL-HPA040361) | |
| Datasheet | Anti CX3CL1 pAb (ATL-HPA040361) Datasheet (External Link) |
| Vendor Page | Anti CX3CL1 pAb (ATL-HPA040361) |
| Citations for Anti CX3CL1 pAb (ATL-HPA040361) – 2 Found |
| Zsiros, Emese; Duttagupta, Priyanka; Dangaj, Denarda; Li, Hongzhe; Frank, Renee; Garrabrant, Thomas; Hagemann, Ian S; Levine, Bruce L; June, Carl H; Zhang, Lin; Wang, Ena; Marincola, Francesco M; Bedognetti, Davide; Powell, Daniel J Jr; Tanyi, Janos; Feldman, Michael D; Kandalaft, Lana E; Coukos, George. The Ovarian Cancer Chemokine Landscape Is Conducive to Homing of Vaccine-Primed and CD3/CD28-Costimulated T Cells Prepared for Adoptive Therapy. Clinical Cancer Research : An Official Journal Of The American Association For Cancer Research. 2015;21(12):2840-50. PubMed |
| Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |