Related products

No related products found

Try browsing our complete catalog of products.

Reviews 0

No reviews have been added for this product.

Reviews

Protein Description: coxsackie virus and adenovirus receptor
Gene Name: CXADR
Alternative Gene Name: CAR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022865: 97%, ENSRNOG00000001557: 88%
Entrez Gene ID: 1525
Uniprot ID: P78310
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application	WB, ICC, IHC
Reactivity	Human
Clonality	Polyclonal
Host	Rabbit
Immunogen	EVHHDIREDVPPPKSRTSTARSYIGSNHSSLGSMSPSNMEGYSKTQYNQVPSEDFERTPQSPTLPPAKVAAPNLS
Gene Sequence	EVHHDIREDVPPPKSRTSTARSYIGSNHSSLGSMSPSNMEGYSKTQYNQVPSEDFERTPQSPTLPPAKVAAPNLS
Gene ID - Mouse	ENSMUSG00000022865
Gene ID - Rat	ENSRNOG00000001557
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CXADR pAb (ATL-HPA030411 w/enhanced validation)
Datasheet	Anti CXADR pAb (ATL-HPA030411 w/enhanced validation) Datasheet (External Link)
Vendor Page	Anti CXADR pAb (ATL-HPA030411 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CXADR pAb (ATL-HPA030411 w/enhanced validation)
Datasheet	Anti CXADR pAb (ATL-HPA030411 w/enhanced validation) Datasheet (External Link)
Vendor Page	Anti CXADR pAb (ATL-HPA030411 w/enhanced validation)

Citations for Anti CXADR pAb (ATL-HPA030411 w/enhanced validation) – 3 Found

Uhlén, Mathias; Oksvold, Per; Älgenäs, Cajsa; Hamsten, Carl; Fagerberg, Linn; Klevebring, Daniel; Lundberg, Emma; Odeberg, Jacob; Pontén, Fredrik; Kondo, Tadashi; Sivertsson, Åsa. Antibody-based protein profiling of the human chromosome 21. Molecular & Cellular Proteomics : Mcp. 2012;11(3):M111.013458. PubMed

Shien, Kazuhiko; Tanaka, Norimitsu; Watanabe, Masami; Soh, Junichi; Sakaguchi, Masakiyo; Matsuo, Keitaro; Yamamoto, Hiromasa; Furukawa, Masashi; Asano, Hiroaki; Tsukuda, Kazunori; Nasu, Yasutomo; Huh, Nam-Ho; Miyoshi, Shinichiro; Kumon, Hiromi; Toyooka, Shinichi. Anti-cancer effects of REIC/Dkk-3-encoding adenoviral vector for the treatment of non-small cell lung cancer. Plos One. 9(2):e87900. PubMed

Schell, Christoph; Kretz, Oliver; Bregenzer, Andreas; Rogg, Manuel; Helmstädter, Martin; Lisewski, Ulrike; Gotthardt, Michael; Tharaux, Pierre-Louis; Huber, Tobias B; Grahammer, Florian. Podocyte-Specific Deletion of Murine CXADR Does Not Impair Podocyte Development, Function or Stress Response. Plos One. 10(6):e0129424. PubMed

No related products found

Reviews 0

Reviews

Anti CXADR pAb (ATL-HPA030411 w/enhanced validation)

Additional information

Specifications

Reviews 0

Anti CXADR pAb (ATL-HPA030411 w/enhanced validation)

Additional information

Specifications

No related products found

Anti CXADR pAb (ATL-HPA030411 w/enhanced validation)

Additional information

Anti CXADR pAb (ATL-HPA030411 w/enhanced validation)

Additional information

Specifications

Specifications