Loading...
Loading...
Loading...
Loading...
Atlas Antibodies
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKF |
| Gene Sequence | SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKF |
| Gene ID - Mouse | ENSMUSG00000029380 |
| Gene ID - Rat | ENSRNOG00000002802 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CXCL8 pAb (ATL-HPA057179) | |
| Datasheet | Anti CXCL8 pAb (ATL-HPA057179) Datasheet (External Link) |
| Vendor Page | Anti CXCL8 pAb (ATL-HPA057179) at Atlas Antibodies |
| Documents & Links for Anti CXCL8 pAb (ATL-HPA057179) | |
| Datasheet | Anti CXCL8 pAb (ATL-HPA057179) Datasheet (External Link) |
| Vendor Page | Anti CXCL8 pAb (ATL-HPA057179) |
| Citations for Anti CXCL8 pAb (ATL-HPA057179) – 3 Found |
| Zhang, Jing-Yue; Du, Yu; Gong, Li-Ping; Shao, Yi-Ting; Wen, Jing-Yun; Sun, Li-Ping; He, Dan; Guo, Jin-Rui; Chen, Jian-Ning; Shao, Chun-Kui. EBV-Induced CXCL8 Upregulation Promotes Vasculogenic Mimicry in Gastric Carcinoma via NF-κB Signaling. Frontiers In Cellular And Infection Microbiology. 12( 35321317):780416. PubMed |
| Tonner, Henrik; Hunn, Selina; Auler, Nadine; Schmelter, Carsten; Beutgen, Vanessa M; von Pein, Harald D; Pfeiffer, Norbert; Grus, Franz H. A Monoclonal Anti-HMGB1 Antibody Attenuates Neurodegeneration in an Experimental Animal Model of Glaucoma. International Journal Of Molecular Sciences. 2022;23(8) PubMed |
| Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKF |
| Gene Sequence | SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKF |
| Gene ID - Mouse | ENSMUSG00000029380 |
| Gene ID - Rat | ENSRNOG00000002802 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CXCL8 pAb (ATL-HPA057179) | |
| Datasheet | Anti CXCL8 pAb (ATL-HPA057179) Datasheet (External Link) |
| Vendor Page | Anti CXCL8 pAb (ATL-HPA057179) at Atlas Antibodies |
| Documents & Links for Anti CXCL8 pAb (ATL-HPA057179) | |
| Datasheet | Anti CXCL8 pAb (ATL-HPA057179) Datasheet (External Link) |
| Vendor Page | Anti CXCL8 pAb (ATL-HPA057179) |
| Citations for Anti CXCL8 pAb (ATL-HPA057179) – 3 Found |
| Zhang, Jing-Yue; Du, Yu; Gong, Li-Ping; Shao, Yi-Ting; Wen, Jing-Yun; Sun, Li-Ping; He, Dan; Guo, Jin-Rui; Chen, Jian-Ning; Shao, Chun-Kui. EBV-Induced CXCL8 Upregulation Promotes Vasculogenic Mimicry in Gastric Carcinoma via NF-κB Signaling. Frontiers In Cellular And Infection Microbiology. 12( 35321317):780416. PubMed |
| Tonner, Henrik; Hunn, Selina; Auler, Nadine; Schmelter, Carsten; Beutgen, Vanessa M; von Pein, Harald D; Pfeiffer, Norbert; Grus, Franz H. A Monoclonal Anti-HMGB1 Antibody Attenuates Neurodegeneration in an Experimental Animal Model of Glaucoma. International Journal Of Molecular Sciences. 2022;23(8) PubMed |
| Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |
No reviews have been added for this product.