Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies






| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKD |
| Gene Sequence | EVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKD |
| Gene ID - Mouse | ENSMUSG00000031924 |
| Gene ID - Rat | ENSRNOG00000011142 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CYB5B pAb (ATL-HPA007893 w/enhanced validation) | |
| Datasheet | Anti CYB5B pAb (ATL-HPA007893 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CYB5B pAb (ATL-HPA007893 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CYB5B pAb (ATL-HPA007893 w/enhanced validation) | |
| Datasheet | Anti CYB5B pAb (ATL-HPA007893 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CYB5B pAb (ATL-HPA007893 w/enhanced validation) |
| Citations for Anti CYB5B pAb (ATL-HPA007893 w/enhanced validation) – 3 Found |
| Neve, Etienne P A; Nordling, Asa; Andersson, Tommy B; Hellman, Ulf; Diczfalusy, Ulf; Johansson, Inger; Ingelman-Sundberg, Magnus. Amidoxime reductase system containing cytochrome b5 type B (CYB5B) and MOSC2 is of importance for lipid synthesis in adipocyte mitochondria. The Journal Of Biological Chemistry. 2012;287(9):6307-17. PubMed |
| Jakobs, Heyka H; Mikula, Michal; Havemeyer, Antje; Strzalkowska, Adriana; Borowa-Chmielak, Monika; Dzwonek, Artur; Gajewska, Marta; Hennig, Ewa E; Ostrowski, Jerzy; Clement, Bernd. The N-reductive system composed of mitochondrial amidoxime reducing component (mARC), cytochrome b5 (CYB5B) and cytochrome b5 reductase (CYB5R) is regulated by fasting and high fat diet in mice. Plos One. 9(8):e105371. PubMed |
| Rixen, Sophia; Havemeyer, Antje; Tyl-Bielicka, Anita; Pysniak, Kazimiera; Gajewska, Marta; Kulecka, Maria; Ostrowski, Jerzy; Mikula, Michal; Clement, Bernd. Mitochondrial amidoxime-reducing component 2 (MARC2) has a significant role in N-reductive activity and energy metabolism. The Journal Of Biological Chemistry. 2019;294(46):17593-17602. PubMed |






| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKD |
| Gene Sequence | EVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKD |
| Gene ID - Mouse | ENSMUSG00000031924 |
| Gene ID - Rat | ENSRNOG00000011142 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CYB5B pAb (ATL-HPA007893 w/enhanced validation) | |
| Datasheet | Anti CYB5B pAb (ATL-HPA007893 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CYB5B pAb (ATL-HPA007893 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CYB5B pAb (ATL-HPA007893 w/enhanced validation) | |
| Datasheet | Anti CYB5B pAb (ATL-HPA007893 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CYB5B pAb (ATL-HPA007893 w/enhanced validation) |
| Citations for Anti CYB5B pAb (ATL-HPA007893 w/enhanced validation) – 3 Found |
| Neve, Etienne P A; Nordling, Asa; Andersson, Tommy B; Hellman, Ulf; Diczfalusy, Ulf; Johansson, Inger; Ingelman-Sundberg, Magnus. Amidoxime reductase system containing cytochrome b5 type B (CYB5B) and MOSC2 is of importance for lipid synthesis in adipocyte mitochondria. The Journal Of Biological Chemistry. 2012;287(9):6307-17. PubMed |
| Jakobs, Heyka H; Mikula, Michal; Havemeyer, Antje; Strzalkowska, Adriana; Borowa-Chmielak, Monika; Dzwonek, Artur; Gajewska, Marta; Hennig, Ewa E; Ostrowski, Jerzy; Clement, Bernd. The N-reductive system composed of mitochondrial amidoxime reducing component (mARC), cytochrome b5 (CYB5B) and cytochrome b5 reductase (CYB5R) is regulated by fasting and high fat diet in mice. Plos One. 9(8):e105371. PubMed |
| Rixen, Sophia; Havemeyer, Antje; Tyl-Bielicka, Anita; Pysniak, Kazimiera; Gajewska, Marta; Kulecka, Maria; Ostrowski, Jerzy; Mikula, Michal; Clement, Bernd. Mitochondrial amidoxime-reducing component 2 (MARC2) has a significant role in N-reductive activity and energy metabolism. The Journal Of Biological Chemistry. 2019;294(46):17593-17602. PubMed |