Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
![Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human cell line A-431<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/41162/17374/atl-hpa001566_anti-cyb5r3-pab-atl-hpa001566_27971__28995.1783622424.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SGLLVYQGKGKFAIRPDKKSNPIIRTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLDRAPEAWDYGQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLDH |
| Gene Sequence | SGLLVYQGKGKFAIRPDKKSNPIIRTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLDRAPEAWDYGQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLDH |
| Gene ID - Mouse | ENSMUSG00000018042 |
| Gene ID - Rat | ENSRNOG00000009592 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CYB5R3 pAb (ATL-HPA001566) | |
| Datasheet | Anti CYB5R3 pAb (ATL-HPA001566) Datasheet (External Link) |
| Vendor Page | Anti CYB5R3 pAb (ATL-HPA001566) at Atlas Antibodies |
| Documents & Links for Anti CYB5R3 pAb (ATL-HPA001566) | |
| Datasheet | Anti CYB5R3 pAb (ATL-HPA001566) Datasheet (External Link) |
| Vendor Page | Anti CYB5R3 pAb (ATL-HPA001566) |
| Citations for Anti CYB5R3 pAb (ATL-HPA001566) – 3 Found |
| Jakobs, Heyka H; Mikula, Michal; Havemeyer, Antje; Strzalkowska, Adriana; Borowa-Chmielak, Monika; Dzwonek, Artur; Gajewska, Marta; Hennig, Ewa E; Ostrowski, Jerzy; Clement, Bernd. The N-reductive system composed of mitochondrial amidoxime reducing component (mARC), cytochrome b5 (CYB5B) and cytochrome b5 reductase (CYB5R) is regulated by fasting and high fat diet in mice. Plos One. 9(8):e105371. PubMed |
| Lund, Rikke R; Leth-Larsen, Rikke; Caterino, Tina Di; Terp, Mikkel G; Nissen, Jeanette; Lænkholm, Anne-Vibeke; Jensen, Ole N; Ditzel, Henrik J. NADH-Cytochrome b5 Reductase 3 Promotes Colonization and Metastasis Formation and Is a Prognostic Marker of Disease-Free and Overall Survival in Estrogen Receptor-Negative Breast Cancer. Molecular & Cellular Proteomics : Mcp. 2015;14(11):2988-99. PubMed |
| Rixen, Sophia; Havemeyer, Antje; Tyl-Bielicka, Anita; Pysniak, Kazimiera; Gajewska, Marta; Kulecka, Maria; Ostrowski, Jerzy; Mikula, Michal; Clement, Bernd. Mitochondrial amidoxime-reducing component 2 (MARC2) has a significant role in N-reductive activity and energy metabolism. The Journal Of Biological Chemistry. 2019;294(46):17593-17602. PubMed |
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SGLLVYQGKGKFAIRPDKKSNPIIRTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLDRAPEAWDYGQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLDH |
| Gene Sequence | SGLLVYQGKGKFAIRPDKKSNPIIRTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLDRAPEAWDYGQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLDH |
| Gene ID - Mouse | ENSMUSG00000018042 |
| Gene ID - Rat | ENSRNOG00000009592 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CYB5R3 pAb (ATL-HPA001566) | |
| Datasheet | Anti CYB5R3 pAb (ATL-HPA001566) Datasheet (External Link) |
| Vendor Page | Anti CYB5R3 pAb (ATL-HPA001566) at Atlas Antibodies |
| Documents & Links for Anti CYB5R3 pAb (ATL-HPA001566) | |
| Datasheet | Anti CYB5R3 pAb (ATL-HPA001566) Datasheet (External Link) |
| Vendor Page | Anti CYB5R3 pAb (ATL-HPA001566) |
| Citations for Anti CYB5R3 pAb (ATL-HPA001566) – 3 Found |
| Jakobs, Heyka H; Mikula, Michal; Havemeyer, Antje; Strzalkowska, Adriana; Borowa-Chmielak, Monika; Dzwonek, Artur; Gajewska, Marta; Hennig, Ewa E; Ostrowski, Jerzy; Clement, Bernd. The N-reductive system composed of mitochondrial amidoxime reducing component (mARC), cytochrome b5 (CYB5B) and cytochrome b5 reductase (CYB5R) is regulated by fasting and high fat diet in mice. Plos One. 9(8):e105371. PubMed |
| Lund, Rikke R; Leth-Larsen, Rikke; Caterino, Tina Di; Terp, Mikkel G; Nissen, Jeanette; Lænkholm, Anne-Vibeke; Jensen, Ole N; Ditzel, Henrik J. NADH-Cytochrome b5 Reductase 3 Promotes Colonization and Metastasis Formation and Is a Prognostic Marker of Disease-Free and Overall Survival in Estrogen Receptor-Negative Breast Cancer. Molecular & Cellular Proteomics : Mcp. 2015;14(11):2988-99. PubMed |
| Rixen, Sophia; Havemeyer, Antje; Tyl-Bielicka, Anita; Pysniak, Kazimiera; Gajewska, Marta; Kulecka, Maria; Ostrowski, Jerzy; Mikula, Michal; Clement, Bernd. Mitochondrial amidoxime-reducing component 2 (MARC2) has a significant role in N-reductive activity and energy metabolism. The Journal Of Biological Chemistry. 2019;294(46):17593-17602. PubMed |