Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RRNWFWGHQGMVNPTEEGMRVLTQLVATYPQGFKVWMGPISPLLSLCHPD |
| Gene Sequence | RRNWFWGHQGMVNPTEEGMRVLTQLVATYPQGFKVWMGPISPLLSLCHPD |
| Gene ID - Mouse | ENSMUSG00000090700 |
| Gene ID - Rat | ENSRNOG00000043344 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CYP4F2 pAb (ATL-HPA014048) | |
| Datasheet | Anti CYP4F2 pAb (ATL-HPA014048) Datasheet (External Link) |
| Vendor Page | Anti CYP4F2 pAb (ATL-HPA014048) at Atlas Antibodies |
| Documents & Links for Anti CYP4F2 pAb (ATL-HPA014048) | |
| Datasheet | Anti CYP4F2 pAb (ATL-HPA014048) Datasheet (External Link) |
| Vendor Page | Anti CYP4F2 pAb (ATL-HPA014048) |
| Citations for Anti CYP4F2 pAb (ATL-HPA014048) – 2 Found |
| Bolander, Asa; Agnarsdóttir, Margrét; Strömberg, Sara; Ponten, Fredrik; Hesselius, Patrik; Uhlen, Mathias; Bergqvist, Michael. The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas. Cancer Genomics & Proteomics. 2008;5(6):293-300. PubMed |
| Alexanian, Anna; Miller, Bradley; Roman, Richard J; Sorokin, Andrey. 20-HETE-producing enzymes are up-regulated in human cancers. Cancer Genomics & Proteomics. 2012;9(4):163-9. PubMed |


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RRNWFWGHQGMVNPTEEGMRVLTQLVATYPQGFKVWMGPISPLLSLCHPD |
| Gene Sequence | RRNWFWGHQGMVNPTEEGMRVLTQLVATYPQGFKVWMGPISPLLSLCHPD |
| Gene ID - Mouse | ENSMUSG00000090700 |
| Gene ID - Rat | ENSRNOG00000043344 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CYP4F2 pAb (ATL-HPA014048) | |
| Datasheet | Anti CYP4F2 pAb (ATL-HPA014048) Datasheet (External Link) |
| Vendor Page | Anti CYP4F2 pAb (ATL-HPA014048) at Atlas Antibodies |
| Documents & Links for Anti CYP4F2 pAb (ATL-HPA014048) | |
| Datasheet | Anti CYP4F2 pAb (ATL-HPA014048) Datasheet (External Link) |
| Vendor Page | Anti CYP4F2 pAb (ATL-HPA014048) |
| Citations for Anti CYP4F2 pAb (ATL-HPA014048) – 2 Found |
| Bolander, Asa; Agnarsdóttir, Margrét; Strömberg, Sara; Ponten, Fredrik; Hesselius, Patrik; Uhlen, Mathias; Bergqvist, Michael. The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas. Cancer Genomics & Proteomics. 2008;5(6):293-300. PubMed |
| Alexanian, Anna; Miller, Bradley; Roman, Richard J; Sorokin, Andrey. 20-HETE-producing enzymes are up-regulated in human cancers. Cancer Genomics & Proteomics. 2012;9(4):163-9. PubMed |