Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies


| Product Specifications | |
| Application | IHC |
| Reactivity | Human, Mouse |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QEEPTYFAIWGDNKAFNEVIISPAMLHEHLPYVVMEGLNKVLENYNKGKTALLSAAKVMVSPTEVDLTPELIFQQQPL |
| Gene Sequence | QEEPTYFAIWGDNKAFNEVIISPAMLHEHLPYVVMEGLNKVLENYNKGKTALLSAAKVMVSPTEVDLTPELIFQQQPL |
| Gene ID - Mouse | ENSMUSG00000035735 |
| Gene ID - Rat | ENSRNOG00000027264 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DAGLA pAb (ATL-HPA062497) | |
| Datasheet | Anti DAGLA pAb (ATL-HPA062497) Datasheet (External Link) |
| Vendor Page | Anti DAGLA pAb (ATL-HPA062497) at Atlas Antibodies |
| Documents & Links for Anti DAGLA pAb (ATL-HPA062497) | |
| Datasheet | Anti DAGLA pAb (ATL-HPA062497) Datasheet (External Link) |
| Vendor Page | Anti DAGLA pAb (ATL-HPA062497) |
| Citations for Anti DAGLA pAb (ATL-HPA062497) – 2 Found |
| Veres, Adrian; Faust, Aubrey L; Bushnell, Henry L; Engquist, Elise N; Kenty, Jennifer Hyoje-Ryu; Harb, George; Poh, Yeh-Chuin; Sintov, Elad; Gürtler, Mads; Pagliuca, Felicia W; Peterson, Quinn P; Melton, Douglas A. Charting cellular identity during human in vitro β-cell differentiation. Nature. 2019;569(7756):368-373. PubMed |
| Nielsen, John E; Rolland, Antoine D; Rajpert-De Meyts, Ewa; Janfelt, Christian; Jørgensen, Anne; Winge, Sofia B; Kristensen, David M; Juul, Anders; Chalmel, Frédéric; Jégou, Bernard; Skakkebaek, Niels E. Characterisation and localisation of the endocannabinoid system components in the adult human testis. Scientific Reports. 2019;9(1):12866. PubMed |


| Product Specifications | |
| Application | IHC |
| Reactivity | Human, Mouse |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QEEPTYFAIWGDNKAFNEVIISPAMLHEHLPYVVMEGLNKVLENYNKGKTALLSAAKVMVSPTEVDLTPELIFQQQPL |
| Gene Sequence | QEEPTYFAIWGDNKAFNEVIISPAMLHEHLPYVVMEGLNKVLENYNKGKTALLSAAKVMVSPTEVDLTPELIFQQQPL |
| Gene ID - Mouse | ENSMUSG00000035735 |
| Gene ID - Rat | ENSRNOG00000027264 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DAGLA pAb (ATL-HPA062497) | |
| Datasheet | Anti DAGLA pAb (ATL-HPA062497) Datasheet (External Link) |
| Vendor Page | Anti DAGLA pAb (ATL-HPA062497) at Atlas Antibodies |
| Documents & Links for Anti DAGLA pAb (ATL-HPA062497) | |
| Datasheet | Anti DAGLA pAb (ATL-HPA062497) Datasheet (External Link) |
| Vendor Page | Anti DAGLA pAb (ATL-HPA062497) |
| Citations for Anti DAGLA pAb (ATL-HPA062497) – 2 Found |
| Veres, Adrian; Faust, Aubrey L; Bushnell, Henry L; Engquist, Elise N; Kenty, Jennifer Hyoje-Ryu; Harb, George; Poh, Yeh-Chuin; Sintov, Elad; Gürtler, Mads; Pagliuca, Felicia W; Peterson, Quinn P; Melton, Douglas A. Charting cellular identity during human in vitro β-cell differentiation. Nature. 2019;569(7756):368-373. PubMed |
| Nielsen, John E; Rolland, Antoine D; Rajpert-De Meyts, Ewa; Janfelt, Christian; Jørgensen, Anne; Winge, Sofia B; Kristensen, David M; Juul, Anders; Chalmel, Frédéric; Jégou, Bernard; Skakkebaek, Niels E. Characterisation and localisation of the endocannabinoid system components in the adult human testis. Scientific Reports. 2019;9(1):12866. PubMed |