Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies


![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/45913/26545/atl-hpa023687_anti-dap3-pab-atl-hpa023687_37368__13941.1783629268.jpg?compression=lossy)


![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/45913/26545/atl-hpa023687_anti-dap3-pab-atl-hpa023687_37368__13941.1783629268.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GSPLGEVVEQGITRVRNATDAVGIVLKELKRQSSLGMFHLLVAVDGINALWGRTTLKREDKSPIAPEELALVHNLRKMMKNDWHGGAIVSALSQTGSLFKPRKAYLPQELLGKEGFDALDPFIPILVSNYNPKEF |
| Gene Sequence | GSPLGEVVEQGITRVRNATDAVGIVLKELKRQSSLGMFHLLVAVDGINALWGRTTLKREDKSPIAPEELALVHNLRKMMKNDWHGGAIVSALSQTGSLFKPRKAYLPQELLGKEGFDALDPFIPILVSNYNPKEF |
| Gene ID - Mouse | ENSMUSG00000068921 |
| Gene ID - Rat | ENSRNOG00000020373 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DAP3 pAb (ATL-HPA023687) | |
| Datasheet | Anti DAP3 pAb (ATL-HPA023687) Datasheet (External Link) |
| Vendor Page | Anti DAP3 pAb (ATL-HPA023687) at Atlas Antibodies |
| Documents & Links for Anti DAP3 pAb (ATL-HPA023687) | |
| Datasheet | Anti DAP3 pAb (ATL-HPA023687) Datasheet (External Link) |
| Vendor Page | Anti DAP3 pAb (ATL-HPA023687) |
| Citations for Anti DAP3 pAb (ATL-HPA023687) – 1 Found |
| Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24. PubMed |


![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/45913/26545/atl-hpa023687_anti-dap3-pab-atl-hpa023687_37368__13941.1783629268.jpg?compression=lossy)


![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/45913/26545/atl-hpa023687_anti-dap3-pab-atl-hpa023687_37368__13941.1783629268.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GSPLGEVVEQGITRVRNATDAVGIVLKELKRQSSLGMFHLLVAVDGINALWGRTTLKREDKSPIAPEELALVHNLRKMMKNDWHGGAIVSALSQTGSLFKPRKAYLPQELLGKEGFDALDPFIPILVSNYNPKEF |
| Gene Sequence | GSPLGEVVEQGITRVRNATDAVGIVLKELKRQSSLGMFHLLVAVDGINALWGRTTLKREDKSPIAPEELALVHNLRKMMKNDWHGGAIVSALSQTGSLFKPRKAYLPQELLGKEGFDALDPFIPILVSNYNPKEF |
| Gene ID - Mouse | ENSMUSG00000068921 |
| Gene ID - Rat | ENSRNOG00000020373 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DAP3 pAb (ATL-HPA023687) | |
| Datasheet | Anti DAP3 pAb (ATL-HPA023687) Datasheet (External Link) |
| Vendor Page | Anti DAP3 pAb (ATL-HPA023687) at Atlas Antibodies |
| Documents & Links for Anti DAP3 pAb (ATL-HPA023687) | |
| Datasheet | Anti DAP3 pAb (ATL-HPA023687) Datasheet (External Link) |
| Vendor Page | Anti DAP3 pAb (ATL-HPA023687) |
| Citations for Anti DAP3 pAb (ATL-HPA023687) – 1 Found |
| Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24. PubMed |