Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies


![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/41944/18932/atl-hpa004201_anti-dazap1-pab-atl-hpa004201-wenhanced-validation_29545__38860.1783623591.jpg?compression=lossy)


![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/41944/18932/atl-hpa004201_anti-dazap1-pab-atl-hpa004201-wenhanced-validation_29545__38860.1783623591.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EPRDSKSQAPGQPGASQWGSRVVPNAANGWAGQPPPTWQQGYGPQGMWVPAGQAIGGYGPPPAGRGAPPPPPPFTSYIVSTPPGGFPPPQGFPQGYGAPPQFSFGYGPPPPPPDQFAPPGVPPPPA |
| Gene Sequence | EPRDSKSQAPGQPGASQWGSRVVPNAANGWAGQPPPTWQQGYGPQGMWVPAGQAIGGYGPPPAGRGAPPPPPPFTSYIVSTPPGGFPPPQGFPQGYGAPPQFSFGYGPPPPPPDQFAPPGVPPPPA |
| Gene ID - Mouse | ENSMUSG00000069565 |
| Gene ID - Rat | ENSRNOG00000031387 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DAZAP1 pAb (ATL-HPA004201 w/enhanced validation) | |
| Datasheet | Anti DAZAP1 pAb (ATL-HPA004201 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DAZAP1 pAb (ATL-HPA004201 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti DAZAP1 pAb (ATL-HPA004201 w/enhanced validation) | |
| Datasheet | Anti DAZAP1 pAb (ATL-HPA004201 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DAZAP1 pAb (ATL-HPA004201 w/enhanced validation) |
| Citations for Anti DAZAP1 pAb (ATL-HPA004201 w/enhanced validation) – 1 Found |
| Buratti, Emanuele; Peruzzo, Paolo; Braga, Luca; Zanin, Irene; Stuani, Cristiana; Goina, Elisa; Romano, Maurizio; Giacca, Mauro; Dardis, Andrea. Deferoxamine mesylate improves splicing and GAA activity of the common c.-32-13T>G allele in late-onset PD patient fibroblasts. Molecular Therapy. Methods & Clinical Development. 2021;20( 33426149):227-236. PubMed |


![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/41944/18932/atl-hpa004201_anti-dazap1-pab-atl-hpa004201-wenhanced-validation_29545__38860.1783623591.jpg?compression=lossy)


![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/41944/18932/atl-hpa004201_anti-dazap1-pab-atl-hpa004201-wenhanced-validation_29545__38860.1783623591.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EPRDSKSQAPGQPGASQWGSRVVPNAANGWAGQPPPTWQQGYGPQGMWVPAGQAIGGYGPPPAGRGAPPPPPPFTSYIVSTPPGGFPPPQGFPQGYGAPPQFSFGYGPPPPPPDQFAPPGVPPPPA |
| Gene Sequence | EPRDSKSQAPGQPGASQWGSRVVPNAANGWAGQPPPTWQQGYGPQGMWVPAGQAIGGYGPPPAGRGAPPPPPPFTSYIVSTPPGGFPPPQGFPQGYGAPPQFSFGYGPPPPPPDQFAPPGVPPPPA |
| Gene ID - Mouse | ENSMUSG00000069565 |
| Gene ID - Rat | ENSRNOG00000031387 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DAZAP1 pAb (ATL-HPA004201 w/enhanced validation) | |
| Datasheet | Anti DAZAP1 pAb (ATL-HPA004201 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DAZAP1 pAb (ATL-HPA004201 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti DAZAP1 pAb (ATL-HPA004201 w/enhanced validation) | |
| Datasheet | Anti DAZAP1 pAb (ATL-HPA004201 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DAZAP1 pAb (ATL-HPA004201 w/enhanced validation) |
| Citations for Anti DAZAP1 pAb (ATL-HPA004201 w/enhanced validation) – 1 Found |
| Buratti, Emanuele; Peruzzo, Paolo; Braga, Luca; Zanin, Irene; Stuani, Cristiana; Goina, Elisa; Romano, Maurizio; Giacca, Mauro; Dardis, Andrea. Deferoxamine mesylate improves splicing and GAA activity of the common c.-32-13T>G allele in late-onset PD patient fibroblasts. Molecular Therapy. Methods & Clinical Development. 2021;20( 33426149):227-236. PubMed |