Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies

![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/55614/43552/atl-hpa051428_anti-dbi-pab-atl-hpa051428_54940__00877.1783641170.jpg?compression=lossy)

![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/55614/43552/atl-hpa051428_anti-dbi-pab-atl-hpa051428_54940__00877.1783641170.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGD |
| Gene Sequence | MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGD |
| Gene ID - Mouse | ENSMUSG00000026385 |
| Gene ID - Rat | ENSRNOG00000046889 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DBI pAb (ATL-HPA051428) | |
| Datasheet | Anti DBI pAb (ATL-HPA051428) Datasheet (External Link) |
| Vendor Page | Anti DBI pAb (ATL-HPA051428) at Atlas Antibodies |
| Documents & Links for Anti DBI pAb (ATL-HPA051428) | |
| Datasheet | Anti DBI pAb (ATL-HPA051428) Datasheet (External Link) |
| Vendor Page | Anti DBI pAb (ATL-HPA051428) |
| Citations for Anti DBI pAb (ATL-HPA051428) – 1 Found |
| Daňhelovská, Tereza; Zdražilová, Lucie; Štufková, Hana; Vanišová, Marie; Volfová, Nikol; Křížová, Jana; Kuda, Ondřej; Sládková, Jana; Tesařová, Markéta. Knock-Out of ACBD3 Leads to Dispersed Golgi Structure, but Unaffected Mitochondrial Functions in HEK293 and HeLa Cells. International Journal Of Molecular Sciences. 2021;22(14) PubMed |

![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/55614/43552/atl-hpa051428_anti-dbi-pab-atl-hpa051428_54940__00877.1783641170.jpg?compression=lossy)

![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/55614/43552/atl-hpa051428_anti-dbi-pab-atl-hpa051428_54940__00877.1783641170.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGD |
| Gene Sequence | MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGD |
| Gene ID - Mouse | ENSMUSG00000026385 |
| Gene ID - Rat | ENSRNOG00000046889 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DBI pAb (ATL-HPA051428) | |
| Datasheet | Anti DBI pAb (ATL-HPA051428) Datasheet (External Link) |
| Vendor Page | Anti DBI pAb (ATL-HPA051428) at Atlas Antibodies |
| Documents & Links for Anti DBI pAb (ATL-HPA051428) | |
| Datasheet | Anti DBI pAb (ATL-HPA051428) Datasheet (External Link) |
| Vendor Page | Anti DBI pAb (ATL-HPA051428) |
| Citations for Anti DBI pAb (ATL-HPA051428) – 1 Found |
| Daňhelovská, Tereza; Zdražilová, Lucie; Štufková, Hana; Vanišová, Marie; Volfová, Nikol; Křížová, Jana; Kuda, Ondřej; Sládková, Jana; Tesařová, Markéta. Knock-Out of ACBD3 Leads to Dispersed Golgi Structure, but Unaffected Mitochondrial Functions in HEK293 and HeLa Cells. International Journal Of Molecular Sciences. 2021;22(14) PubMed |