Related products

No related products found

Try browsing our complete catalog of products.

Reviews 0

No reviews have been added for this product.

Reviews

Protein Description: DCC netrin 1 receptor
Gene Name: DCC
Alternative Gene Name: IGDCC1, NTN1R1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060534: 98%, ENSRNOG00000033099: 98%
Entrez Gene ID: 1630
Uniprot ID: P43146
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Alternative antibody for ATL-HPA055376

Product Specifications
Application	IHC
Reactivity	Human
Clonality	Polyclonal
Host	Rabbit
Immunogen	ACVRPTHPLRSFANPLLPPPMSAIEPKVPYTPLLSQPGPTLPKTHVKTASLGLAGKARSPLLPVSVPTAPEVSEESHKPTEDSANVYEQDDLSEQMAS
Gene Sequence	ACVRPTHPLRSFANPLLPPPMSAIEPKVPYTPLLSQPGPTLPKTHVKTASLGLAGKARSPLLPVSVPTAPEVSEESHKPTEDSANVYEQDDLSEQMAS
Gene ID - Mouse	ENSMUSG00000060534
Gene ID - Rat	ENSRNOG00000033099
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DCC pAb (ATL-HPA069552)
Datasheet	Anti DCC pAb (ATL-HPA069552) Datasheet (External Link)
Vendor Page	Anti DCC pAb (ATL-HPA069552) at Atlas Antibodies

Documents & Links for Anti DCC pAb (ATL-HPA069552)
Datasheet	Anti DCC pAb (ATL-HPA069552) Datasheet (External Link)
Vendor Page	Anti DCC pAb (ATL-HPA069552)

Citations for Anti DCC pAb (ATL-HPA069552) – 1 Found

Patthey, Cedric; Tong, Yong Guang; Tait, Christine Mary; Wilson, Sara Ivy. Evolution of the functionally conserved DCC gene in birds. Scientific Reports. 2017;7( 28240293):42029. PubMed

No related products found

Reviews 0

Reviews

Anti DCC pAb (ATL-HPA069552)

Additional information

Anti DCC pAb (ATL-HPA069552)

Additional information

Specifications

No related products found

Reviews 0

Anti DCC pAb (ATL-HPA069552)

Additional information

Specifications

Anti DCC pAb (ATL-HPA069552)

Additional information

Specifications

Specifications