Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies




| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VEASDGGNPDLRALTLVEIGIEDMNNYAPEFTVKSYNLSLSEDALVGSTLVTFSNIDHDWTRENTYVEYSIISGNSQN |
| Gene Sequence | VEASDGGNPDLRALTLVEIGIEDMNNYAPEFTVKSYNLSLSEDALVGSTLVTFSNIDHDWTRENTYVEYSIISGNSQN |
| Gene ID - Mouse | ENSMUSG00000102692 |
| Gene ID - Rat | ENSRNOG00000031643 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DCHS2 pAb (ATL-HPA064159) | |
| Datasheet | Anti DCHS2 pAb (ATL-HPA064159) Datasheet (External Link) |
| Vendor Page | Anti DCHS2 pAb (ATL-HPA064159) at Atlas Antibodies |
| Documents & Links for Anti DCHS2 pAb (ATL-HPA064159) | |
| Datasheet | Anti DCHS2 pAb (ATL-HPA064159) Datasheet (External Link) |
| Vendor Page | Anti DCHS2 pAb (ATL-HPA064159) |
| Citations for Anti DCHS2 pAb (ATL-HPA064159) – 2 Found |
| Verstockt, Bram; Verstockt, Sare; Veny, Marisol; Dehairs, Jonas; Arnauts, Kaline; Van Assche, Gert; De Hertogh, Gert; Vermeire, Séverine; Salas, Azucena; Ferrante, Marc. Expression Levels of 4 Genes in Colon Tissue Might Be Used to Predict Which Patients Will Enter Endoscopic Remission After Vedolizumab Therapy for Inflammatory Bowel Diseases. Clinical Gastroenterology And Hepatology : The Official Clinical Practice Journal Of The American Gastroenterological Association. 2020;18(5):1142-1151.e10. PubMed |
| Lodge, Emily J; Xekouki, Paraskevi; Silva, Tatiane S; Kochi, Cristiane; Longui, Carlos A; Faucz, Fabio R; Santambrogio, Alice; Mills, James L; Pankratz, Nathan; Lane, John; Sosnowska, Dominika; Hodgson, Tina; Patist, Amanda L; Francis-West, Philippa; Helmbacher, Francoise; Stratakis, Constantine; Andoniadou, Cynthia L. Requirement of FAT and DCHS protocadherins during hypothalamic-pituitary development. Jci Insight. 2020;5(23) PubMed |




| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VEASDGGNPDLRALTLVEIGIEDMNNYAPEFTVKSYNLSLSEDALVGSTLVTFSNIDHDWTRENTYVEYSIISGNSQN |
| Gene Sequence | VEASDGGNPDLRALTLVEIGIEDMNNYAPEFTVKSYNLSLSEDALVGSTLVTFSNIDHDWTRENTYVEYSIISGNSQN |
| Gene ID - Mouse | ENSMUSG00000102692 |
| Gene ID - Rat | ENSRNOG00000031643 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DCHS2 pAb (ATL-HPA064159) | |
| Datasheet | Anti DCHS2 pAb (ATL-HPA064159) Datasheet (External Link) |
| Vendor Page | Anti DCHS2 pAb (ATL-HPA064159) at Atlas Antibodies |
| Documents & Links for Anti DCHS2 pAb (ATL-HPA064159) | |
| Datasheet | Anti DCHS2 pAb (ATL-HPA064159) Datasheet (External Link) |
| Vendor Page | Anti DCHS2 pAb (ATL-HPA064159) |
| Citations for Anti DCHS2 pAb (ATL-HPA064159) – 2 Found |
| Verstockt, Bram; Verstockt, Sare; Veny, Marisol; Dehairs, Jonas; Arnauts, Kaline; Van Assche, Gert; De Hertogh, Gert; Vermeire, Séverine; Salas, Azucena; Ferrante, Marc. Expression Levels of 4 Genes in Colon Tissue Might Be Used to Predict Which Patients Will Enter Endoscopic Remission After Vedolizumab Therapy for Inflammatory Bowel Diseases. Clinical Gastroenterology And Hepatology : The Official Clinical Practice Journal Of The American Gastroenterological Association. 2020;18(5):1142-1151.e10. PubMed |
| Lodge, Emily J; Xekouki, Paraskevi; Silva, Tatiane S; Kochi, Cristiane; Longui, Carlos A; Faucz, Fabio R; Santambrogio, Alice; Mills, James L; Pankratz, Nathan; Lane, John; Sosnowska, Dominika; Hodgson, Tina; Patist, Amanda L; Francis-West, Philippa; Helmbacher, Francoise; Stratakis, Constantine; Andoniadou, Cynthia L. Requirement of FAT and DCHS protocadherins during hypothalamic-pituitary development. Jci Insight. 2020;5(23) PubMed |