Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies




| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSY |
| Gene Sequence | VSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSY |
| Gene ID - Mouse | ENSMUSG00000019929 |
| Gene ID - Rat | ENSRNOG00000004554 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DCN pAb (ATL-HPA064736 w/enhanced validation) | |
| Datasheet | Anti DCN pAb (ATL-HPA064736 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DCN pAb (ATL-HPA064736 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti DCN pAb (ATL-HPA064736 w/enhanced validation) | |
| Datasheet | Anti DCN pAb (ATL-HPA064736 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DCN pAb (ATL-HPA064736 w/enhanced validation) |
| Citations for Anti DCN pAb (ATL-HPA064736 w/enhanced validation) – 1 Found |
| Hu, Xiaoding; Villodre, Emilly S; Larson, Richard; Rahal, Omar M; Wang, Xiaoping; Gong, Yun; Song, Juhee; Krishnamurthy, Savitri; Ueno, Naoto T; Tripathy, Debu; Woodward, Wendy A; Debeb, Bisrat G. Decorin-mediated suppression of tumorigenesis, invasion, and metastasis in inflammatory breast cancer. Communications Biology. 2021;4(1):72. PubMed |




| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSY |
| Gene Sequence | VSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSY |
| Gene ID - Mouse | ENSMUSG00000019929 |
| Gene ID - Rat | ENSRNOG00000004554 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DCN pAb (ATL-HPA064736 w/enhanced validation) | |
| Datasheet | Anti DCN pAb (ATL-HPA064736 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DCN pAb (ATL-HPA064736 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti DCN pAb (ATL-HPA064736 w/enhanced validation) | |
| Datasheet | Anti DCN pAb (ATL-HPA064736 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DCN pAb (ATL-HPA064736 w/enhanced validation) |
| Citations for Anti DCN pAb (ATL-HPA064736 w/enhanced validation) – 1 Found |
| Hu, Xiaoding; Villodre, Emilly S; Larson, Richard; Rahal, Omar M; Wang, Xiaoping; Gong, Yun; Song, Juhee; Krishnamurthy, Savitri; Ueno, Naoto T; Tripathy, Debu; Woodward, Wendy A; Debeb, Bisrat G. Decorin-mediated suppression of tumorigenesis, invasion, and metastasis in inflammatory breast cancer. Communications Biology. 2021;4(1):72. PubMed |