Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YDAQVFRLPGPSRAQCLTTCRSVRERESHSRKSASSCDVSSSPSLPSRTLPTEEVRSQASDDSSLGKSANILMIPHPHLHQYEVSSS |
| Gene Sequence | YDAQVFRLPGPSRAQCLTTCRSVRERESHSRKSASSCDVSSSPSLPSRTLPTEEVRSQASDDSSLGKSANILMIPHPHLHQYEVSSS |
| Gene ID - Mouse | ENSMUSG00000037426 |
| Gene ID - Rat | ENSRNOG00000018144 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DEPDC5 pAb (ATL-HPA055619) | |
| Datasheet | Anti DEPDC5 pAb (ATL-HPA055619) Datasheet (External Link) |
| Vendor Page | Anti DEPDC5 pAb (ATL-HPA055619) at Atlas Antibodies |
| Documents & Links for Anti DEPDC5 pAb (ATL-HPA055619) | |
| Datasheet | Anti DEPDC5 pAb (ATL-HPA055619) Datasheet (External Link) |
| Vendor Page | Anti DEPDC5 pAb (ATL-HPA055619) |
| Citations for Anti DEPDC5 pAb (ATL-HPA055619) – 3 Found |
| Mizuno, Yuki; Shimada, Shu; Akiyama, Yoshimitsu; Watanabe, Shuichi; Aida, Tomomi; Ogawa, Kosuke; Ono, Hiroaki; Mitsunori, Yusuke; Ban, Daisuke; Kudo, Atsushi; Arii, Shigeki; Yamaoka, Shoji; Tanabe, Minoru; Tanaka, Shinji. DEPDC5 deficiency contributes to resistance to leucine starvation via p62 accumulation in hepatocellular carcinoma. Scientific Reports. 2018;8(1):106. PubMed |
| Yuskaitis, Christopher J; Modasia, Jinita B; Schrötter, Sandra; Rossitto, Leigh-Ana; Groff, Karenna J; Morici, Christopher; Mithal, Divakar S; Chakrabarty, Ram P; Chandel, Navdeep S; Manning, Brendan D; Sahin, Mustafa. DEPDC5-dependent mTORC1 signaling mechanisms are critical for the anti-seizure effects of acute fasting. Cell Reports. 2022;40(9):111278. PubMed |
| Wang, Ya-Chin; Tsai, Ming-Chao; Chen, Yaw-Sen; Hsieh, Pei-Min; Hung, Chao-Ming; Lin, Hung-Yu; Hsu, Yao-Chun; Yeh, Jen-Hao; Hsiao, Pojen; Su, Yu-Cheih; Ma, Ching-Hou; Lee, Chih-Yuan; Lin, Chih-Che; Shu, Chih-Wen; Li, Yu-Chan; Tsai, Mei-Hsing; Lin, James Yu; Peng, Wei-Hao; Yu, Ming-Lung; Lin, Chih-Wen. NPRL2 down-regulation facilitates the growth of hepatocellular carcinoma via the mTOR pathway and autophagy suppression. Hepatology Communications. 2022;6(12):3563-3577. PubMed |
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YDAQVFRLPGPSRAQCLTTCRSVRERESHSRKSASSCDVSSSPSLPSRTLPTEEVRSQASDDSSLGKSANILMIPHPHLHQYEVSSS |
| Gene Sequence | YDAQVFRLPGPSRAQCLTTCRSVRERESHSRKSASSCDVSSSPSLPSRTLPTEEVRSQASDDSSLGKSANILMIPHPHLHQYEVSSS |
| Gene ID - Mouse | ENSMUSG00000037426 |
| Gene ID - Rat | ENSRNOG00000018144 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DEPDC5 pAb (ATL-HPA055619) | |
| Datasheet | Anti DEPDC5 pAb (ATL-HPA055619) Datasheet (External Link) |
| Vendor Page | Anti DEPDC5 pAb (ATL-HPA055619) at Atlas Antibodies |
| Documents & Links for Anti DEPDC5 pAb (ATL-HPA055619) | |
| Datasheet | Anti DEPDC5 pAb (ATL-HPA055619) Datasheet (External Link) |
| Vendor Page | Anti DEPDC5 pAb (ATL-HPA055619) |
| Citations for Anti DEPDC5 pAb (ATL-HPA055619) – 3 Found |
| Mizuno, Yuki; Shimada, Shu; Akiyama, Yoshimitsu; Watanabe, Shuichi; Aida, Tomomi; Ogawa, Kosuke; Ono, Hiroaki; Mitsunori, Yusuke; Ban, Daisuke; Kudo, Atsushi; Arii, Shigeki; Yamaoka, Shoji; Tanabe, Minoru; Tanaka, Shinji. DEPDC5 deficiency contributes to resistance to leucine starvation via p62 accumulation in hepatocellular carcinoma. Scientific Reports. 2018;8(1):106. PubMed |
| Yuskaitis, Christopher J; Modasia, Jinita B; Schrötter, Sandra; Rossitto, Leigh-Ana; Groff, Karenna J; Morici, Christopher; Mithal, Divakar S; Chakrabarty, Ram P; Chandel, Navdeep S; Manning, Brendan D; Sahin, Mustafa. DEPDC5-dependent mTORC1 signaling mechanisms are critical for the anti-seizure effects of acute fasting. Cell Reports. 2022;40(9):111278. PubMed |
| Wang, Ya-Chin; Tsai, Ming-Chao; Chen, Yaw-Sen; Hsieh, Pei-Min; Hung, Chao-Ming; Lin, Hung-Yu; Hsu, Yao-Chun; Yeh, Jen-Hao; Hsiao, Pojen; Su, Yu-Cheih; Ma, Ching-Hou; Lee, Chih-Yuan; Lin, Chih-Che; Shu, Chih-Wen; Li, Yu-Chan; Tsai, Mei-Hsing; Lin, James Yu; Peng, Wei-Hao; Yu, Ming-Lung; Lin, Chih-Wen. NPRL2 down-regulation facilitates the growth of hepatocellular carcinoma via the mTOR pathway and autophagy suppression. Hepatology Communications. 2022;6(12):3563-3577. PubMed |