Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL |
| Gene Sequence | KLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL |
| Gene ID - Mouse | ENSMUSG00000026208 |
| Gene ID - Rat | ENSRNOG00000019810 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DES pAb (ATL-HPA018803 w/enhanced validation) | |
| Datasheet | Anti DES pAb (ATL-HPA018803 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DES pAb (ATL-HPA018803 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti DES pAb (ATL-HPA018803 w/enhanced validation) | |
| Datasheet | Anti DES pAb (ATL-HPA018803 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DES pAb (ATL-HPA018803 w/enhanced validation) |
| Citations for Anti DES pAb (ATL-HPA018803 w/enhanced validation) – 2 Found |
| Signorelli, Mirko; Ayoglu, Burcu; Johansson, Camilla; Lochmüller, Hanns; Straub, Volker; Muntoni, Francesco; Niks, Erik; Tsonaka, Roula; Persson, Anja; Aartsma-Rus, Annemieke; Nilsson, Peter; Al-Khalili Szigyarto, Cristina; Spitali, Pietro. Longitudinal serum biomarker screening identifies malate dehydrogenase 2 as candidate prognostic biomarker for Duchenne muscular dystrophy. Journal Of Cachexia, Sarcopenia And Muscle. 2020;11(2):505-517. PubMed |
| Lee, Soo Jung; Kondepudi, Akhil; Young, Kelly Z; Zhang, Xiaojie; Cartee, Naw May Pearl; Chen, Jijun; Jang, Krystal Yujin; Xu, Gang; Borjigin, Jimo; Wang, Michael M. Concentration of non-myocyte proteins in arterial media of cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy. Plos One. 18(2):e0281094. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL |
| Gene Sequence | KLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL |
| Gene ID - Mouse | ENSMUSG00000026208 |
| Gene ID - Rat | ENSRNOG00000019810 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DES pAb (ATL-HPA018803 w/enhanced validation) | |
| Datasheet | Anti DES pAb (ATL-HPA018803 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DES pAb (ATL-HPA018803 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti DES pAb (ATL-HPA018803 w/enhanced validation) | |
| Datasheet | Anti DES pAb (ATL-HPA018803 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DES pAb (ATL-HPA018803 w/enhanced validation) |
| Citations for Anti DES pAb (ATL-HPA018803 w/enhanced validation) – 2 Found |
| Signorelli, Mirko; Ayoglu, Burcu; Johansson, Camilla; Lochmüller, Hanns; Straub, Volker; Muntoni, Francesco; Niks, Erik; Tsonaka, Roula; Persson, Anja; Aartsma-Rus, Annemieke; Nilsson, Peter; Al-Khalili Szigyarto, Cristina; Spitali, Pietro. Longitudinal serum biomarker screening identifies malate dehydrogenase 2 as candidate prognostic biomarker for Duchenne muscular dystrophy. Journal Of Cachexia, Sarcopenia And Muscle. 2020;11(2):505-517. PubMed |
| Lee, Soo Jung; Kondepudi, Akhil; Young, Kelly Z; Zhang, Xiaojie; Cartee, Naw May Pearl; Chen, Jijun; Jang, Krystal Yujin; Xu, Gang; Borjigin, Jimo; Wang, Michael M. Concentration of non-myocyte proteins in arterial media of cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy. Plos One. 18(2):e0281094. PubMed |