Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies

![Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human cell line A-431](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/41044/17141/atl-hpa001222_anti-dgcr14-pab-atl-hpa001222-wenhanced-validation_27728__99458.1783622255.jpg?compression=lossy)

![Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human cell line A-431](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/41044/17141/atl-hpa001222_anti-dgcr14-pab-atl-hpa001222-wenhanced-validation_27728__99458.1783622255.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LRVEGSETPYVDRTPGPAFKILEPGRRERLGLKMANEAAAKNRAKKQEALRRVTENLASLTPKGLSPAMSPALQRLVSRTASKYTDRALRASYTPSPARSTHLKTPASGLQTPTSTPAPGSATRTPLTQDPASITDNL |
| Gene Sequence | LRVEGSETPYVDRTPGPAFKILEPGRRERLGLKMANEAAAKNRAKKQEALRRVTENLASLTPKGLSPAMSPALQRLVSRTASKYTDRALRASYTPSPARSTHLKTPASGLQTPTSTPAPGSATRTPLTQDPASITDNL |
| Gene ID - Mouse | ENSMUSG00000003527 |
| Gene ID - Rat | ENSRNOG00000000283 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DGCR14 pAb (ATL-HPA001222 w/enhanced validation) | |
| Datasheet | Anti DGCR14 pAb (ATL-HPA001222 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DGCR14 pAb (ATL-HPA001222 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti DGCR14 pAb (ATL-HPA001222 w/enhanced validation) | |
| Datasheet | Anti DGCR14 pAb (ATL-HPA001222 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DGCR14 pAb (ATL-HPA001222 w/enhanced validation) |

![Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human cell line A-431](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/41044/17141/atl-hpa001222_anti-dgcr14-pab-atl-hpa001222-wenhanced-validation_27728__99458.1783622255.jpg?compression=lossy)

![Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human cell line A-431](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/41044/17141/atl-hpa001222_anti-dgcr14-pab-atl-hpa001222-wenhanced-validation_27728__99458.1783622255.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LRVEGSETPYVDRTPGPAFKILEPGRRERLGLKMANEAAAKNRAKKQEALRRVTENLASLTPKGLSPAMSPALQRLVSRTASKYTDRALRASYTPSPARSTHLKTPASGLQTPTSTPAPGSATRTPLTQDPASITDNL |
| Gene Sequence | LRVEGSETPYVDRTPGPAFKILEPGRRERLGLKMANEAAAKNRAKKQEALRRVTENLASLTPKGLSPAMSPALQRLVSRTASKYTDRALRASYTPSPARSTHLKTPASGLQTPTSTPAPGSATRTPLTQDPASITDNL |
| Gene ID - Mouse | ENSMUSG00000003527 |
| Gene ID - Rat | ENSRNOG00000000283 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DGCR14 pAb (ATL-HPA001222 w/enhanced validation) | |
| Datasheet | Anti DGCR14 pAb (ATL-HPA001222 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DGCR14 pAb (ATL-HPA001222 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti DGCR14 pAb (ATL-HPA001222 w/enhanced validation) | |
| Datasheet | Anti DGCR14 pAb (ATL-HPA001222 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DGCR14 pAb (ATL-HPA001222 w/enhanced validation) |