Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HVSLFVGGLPPGLSPEEYSSLLHEAGATKATVVSVSHIYSSQGAVVLDVACFAEAERLYMLLKDMAVRGRLLTALVLPDLLHAKLPPDSCPLLVFVNPKSG |
| Gene Sequence | HVSLFVGGLPPGLSPEEYSSLLHEAGATKATVVSVSHIYSSQGAVVLDVACFAEAERLYMLLKDMAVRGRLLTALVLPDLLHAKLPPDSCPLLVFVNPKSG |
| Gene ID - Mouse | ENSMUSG00000004815 |
| Gene ID - Rat | ENSRNOG00000024112 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DGKQ pAb (ATL-HPA026797) | |
| Datasheet | Anti DGKQ pAb (ATL-HPA026797) Datasheet (External Link) |
| Vendor Page | Anti DGKQ pAb (ATL-HPA026797) at Atlas Antibodies |
| Documents & Links for Anti DGKQ pAb (ATL-HPA026797) | |
| Datasheet | Anti DGKQ pAb (ATL-HPA026797) Datasheet (External Link) |
| Vendor Page | Anti DGKQ pAb (ATL-HPA026797) |
| Citations for Anti DGKQ pAb (ATL-HPA026797) – 3 Found |
| Cai, Kai; Sewer, Marion B. cAMP-stimulated transcription of DGKθ requires steroidogenic factor 1 and sterol regulatory element binding protein 1. Journal Of Lipid Research. 2013;54(8):2121-2132. PubMed |
| Cai, Kai; Sewer, Marion B. Diacylglycerol kinase θ couples farnesoid X receptor-dependent bile acid signalling to Akt activation and glucose homoeostasis in hepatocytes. The Biochemical Journal. 2013;454(2):267-74. PubMed |
| Cai, Kai; Lucki, Natasha C; Sewer, Marion B. Silencing diacylglycerol kinase-theta expression reduces steroid hormone biosynthesis and cholesterol metabolism in human adrenocortical cells. Biochimica Et Biophysica Acta. 2014;1841(4):552-62. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HVSLFVGGLPPGLSPEEYSSLLHEAGATKATVVSVSHIYSSQGAVVLDVACFAEAERLYMLLKDMAVRGRLLTALVLPDLLHAKLPPDSCPLLVFVNPKSG |
| Gene Sequence | HVSLFVGGLPPGLSPEEYSSLLHEAGATKATVVSVSHIYSSQGAVVLDVACFAEAERLYMLLKDMAVRGRLLTALVLPDLLHAKLPPDSCPLLVFVNPKSG |
| Gene ID - Mouse | ENSMUSG00000004815 |
| Gene ID - Rat | ENSRNOG00000024112 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DGKQ pAb (ATL-HPA026797) | |
| Datasheet | Anti DGKQ pAb (ATL-HPA026797) Datasheet (External Link) |
| Vendor Page | Anti DGKQ pAb (ATL-HPA026797) at Atlas Antibodies |
| Documents & Links for Anti DGKQ pAb (ATL-HPA026797) | |
| Datasheet | Anti DGKQ pAb (ATL-HPA026797) Datasheet (External Link) |
| Vendor Page | Anti DGKQ pAb (ATL-HPA026797) |
| Citations for Anti DGKQ pAb (ATL-HPA026797) – 3 Found |
| Cai, Kai; Sewer, Marion B. cAMP-stimulated transcription of DGKθ requires steroidogenic factor 1 and sterol regulatory element binding protein 1. Journal Of Lipid Research. 2013;54(8):2121-2132. PubMed |
| Cai, Kai; Sewer, Marion B. Diacylglycerol kinase θ couples farnesoid X receptor-dependent bile acid signalling to Akt activation and glucose homoeostasis in hepatocytes. The Biochemical Journal. 2013;454(2):267-74. PubMed |
| Cai, Kai; Lucki, Natasha C; Sewer, Marion B. Silencing diacylglycerol kinase-theta expression reduces steroid hormone biosynthesis and cholesterol metabolism in human adrenocortical cells. Biochimica Et Biophysica Acta. 2014;1841(4):552-62. PubMed |