Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies




| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EIKSSYYAKLNDHLNNMAHYRPPALNLQAHWQGLAQPEAQITTWSTGVPLDLLRFVGMKSVEVPRELQMHSHLLKTHVQSRMEKMMDG |
| Gene Sequence | EIKSSYYAKLNDHLNNMAHYRPPALNLQAHWQGLAQPEAQITTWSTGVPLDLLRFVGMKSVEVPRELQMHSHLLKTHVQSRMEKMMDG |
| Gene ID - Mouse | ENSMUSG00000025815 |
| Gene ID - Rat | ENSRNOG00000062048 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DHTKD1 pAb (ATL-HPA037950) | |
| Datasheet | Anti DHTKD1 pAb (ATL-HPA037950) Datasheet (External Link) |
| Vendor Page | Anti DHTKD1 pAb (ATL-HPA037950) at Atlas Antibodies |
| Documents & Links for Anti DHTKD1 pAb (ATL-HPA037950) | |
| Datasheet | Anti DHTKD1 pAb (ATL-HPA037950) Datasheet (External Link) |
| Vendor Page | Anti DHTKD1 pAb (ATL-HPA037950) |
| Citations for Anti DHTKD1 pAb (ATL-HPA037950) – 1 Found |
| Sherrill, Joseph D; Kc, Kiran; Wang, Xinjian; Wen, Ting; Chamberlin, Adam; Stucke, Emily M; Collins, Margaret H; Abonia, J Pablo; Peng, Yanyan; Wu, Qiang; Putnam, Philip E; Dexheimer, Phillip J; Aronow, Bruce J; Kottyan, Leah C; Kaufman, Kenneth M; Harley, John B; Huang, Taosheng; Rothenberg, Marc E. Whole-exome sequencing uncovers oxidoreductases DHTKD1 and OGDHL as linkers between mitochondrial dysfunction and eosinophilic esophagitis. Jci Insight. 2018;3(8) PubMed |




| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EIKSSYYAKLNDHLNNMAHYRPPALNLQAHWQGLAQPEAQITTWSTGVPLDLLRFVGMKSVEVPRELQMHSHLLKTHVQSRMEKMMDG |
| Gene Sequence | EIKSSYYAKLNDHLNNMAHYRPPALNLQAHWQGLAQPEAQITTWSTGVPLDLLRFVGMKSVEVPRELQMHSHLLKTHVQSRMEKMMDG |
| Gene ID - Mouse | ENSMUSG00000025815 |
| Gene ID - Rat | ENSRNOG00000062048 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DHTKD1 pAb (ATL-HPA037950) | |
| Datasheet | Anti DHTKD1 pAb (ATL-HPA037950) Datasheet (External Link) |
| Vendor Page | Anti DHTKD1 pAb (ATL-HPA037950) at Atlas Antibodies |
| Documents & Links for Anti DHTKD1 pAb (ATL-HPA037950) | |
| Datasheet | Anti DHTKD1 pAb (ATL-HPA037950) Datasheet (External Link) |
| Vendor Page | Anti DHTKD1 pAb (ATL-HPA037950) |
| Citations for Anti DHTKD1 pAb (ATL-HPA037950) – 1 Found |
| Sherrill, Joseph D; Kc, Kiran; Wang, Xinjian; Wen, Ting; Chamberlin, Adam; Stucke, Emily M; Collins, Margaret H; Abonia, J Pablo; Peng, Yanyan; Wu, Qiang; Putnam, Philip E; Dexheimer, Phillip J; Aronow, Bruce J; Kottyan, Leah C; Kaufman, Kenneth M; Harley, John B; Huang, Taosheng; Rothenberg, Marc E. Whole-exome sequencing uncovers oxidoreductases DHTKD1 and OGDHL as linkers between mitochondrial dysfunction and eosinophilic esophagitis. Jci Insight. 2018;3(8) PubMed |