Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies
![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/55102/42712/atl-hpa049904_anti-dido1-pab-atl-hpa049904_54062__19754.1783640607.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PHPSQFETARGPHPNQFEGPRGQAPNFMPGPRGIQPQQFEDQRVHSPPRFTNQRAPAPLQFGGLRGSAPFSEKNEQTPSRFHFQGQ |
| Gene Sequence | PHPSQFETARGPHPNQFEGPRGQAPNFMPGPRGIQPQQFEDQRVHSPPRFTNQRAPAPLQFGGLRGSAPFSEKNEQTPSRFHFQGQ |
| Gene ID - Mouse | ENSMUSG00000038914 |
| Gene ID - Rat | ENSRNOG00000009936 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DIDO1 pAb (ATL-HPA049904) | |
| Datasheet | Anti DIDO1 pAb (ATL-HPA049904) Datasheet (External Link) |
| Vendor Page | Anti DIDO1 pAb (ATL-HPA049904) at Atlas Antibodies |
| Documents & Links for Anti DIDO1 pAb (ATL-HPA049904) | |
| Datasheet | Anti DIDO1 pAb (ATL-HPA049904) Datasheet (External Link) |
| Vendor Page | Anti DIDO1 pAb (ATL-HPA049904) |
| Citations for Anti DIDO1 pAb (ATL-HPA049904) – 1 Found |
| Cao, Honghua; Wang, Lilan; Geng, Chengkui; Yang, Man; Mao, Wenwen; Yang, Linlin; Ma, Yin; He, Ming; Zhou, Yeying; Liu, Lianqing; Hu, Xuejiao; Yu, Jingxing; Shen, Xiufen; Gu, Xuezhong; Yin, Liefen; Shen, Zhenglei. In leukemia, knock-down of the death inducer-obliterator gene would inhibit the proliferation of endothelial cells by inhibiting the expression of CDK6 and CCND1. Peerj. 10( 35178295):e12832. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PHPSQFETARGPHPNQFEGPRGQAPNFMPGPRGIQPQQFEDQRVHSPPRFTNQRAPAPLQFGGLRGSAPFSEKNEQTPSRFHFQGQ |
| Gene Sequence | PHPSQFETARGPHPNQFEGPRGQAPNFMPGPRGIQPQQFEDQRVHSPPRFTNQRAPAPLQFGGLRGSAPFSEKNEQTPSRFHFQGQ |
| Gene ID - Mouse | ENSMUSG00000038914 |
| Gene ID - Rat | ENSRNOG00000009936 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DIDO1 pAb (ATL-HPA049904) | |
| Datasheet | Anti DIDO1 pAb (ATL-HPA049904) Datasheet (External Link) |
| Vendor Page | Anti DIDO1 pAb (ATL-HPA049904) at Atlas Antibodies |
| Documents & Links for Anti DIDO1 pAb (ATL-HPA049904) | |
| Datasheet | Anti DIDO1 pAb (ATL-HPA049904) Datasheet (External Link) |
| Vendor Page | Anti DIDO1 pAb (ATL-HPA049904) |
| Citations for Anti DIDO1 pAb (ATL-HPA049904) – 1 Found |
| Cao, Honghua; Wang, Lilan; Geng, Chengkui; Yang, Man; Mao, Wenwen; Yang, Linlin; Ma, Yin; He, Ming; Zhou, Yeying; Liu, Lianqing; Hu, Xuejiao; Yu, Jingxing; Shen, Xiufen; Gu, Xuezhong; Yin, Liefen; Shen, Zhenglei. In leukemia, knock-down of the death inducer-obliterator gene would inhibit the proliferation of endothelial cells by inhibiting the expression of CDK6 and CCND1. Peerj. 10( 35178295):e12832. PubMed |