Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GGLMFNTGIGQHILKNPLIINSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAELHKRVQGTPVASKLQVLVGDVLKTDLPFFDTCV |
| Gene Sequence | GGLMFNTGIGQHILKNPLIINSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAELHKRVQGTPVASKLQVLVGDVLKTDLPFFDTCV |
| Gene ID - Mouse | ENSMUSG00000021692 |
| Gene ID - Rat | ENSRNOG00000013596 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DIMT1 pAb (ATL-HPA042944) | |
| Datasheet | Anti DIMT1 pAb (ATL-HPA042944) Datasheet (External Link) |
| Vendor Page | Anti DIMT1 pAb (ATL-HPA042944) at Atlas Antibodies |
| Documents & Links for Anti DIMT1 pAb (ATL-HPA042944) | |
| Datasheet | Anti DIMT1 pAb (ATL-HPA042944) Datasheet (External Link) |
| Vendor Page | Anti DIMT1 pAb (ATL-HPA042944) |
| Citations for Anti DIMT1 pAb (ATL-HPA042944) – 2 Found |
| Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24. PubMed |
| Zhou, Hai-Zhen; Chen, Bo; Li, Xiao-Ju; Du, Juan-Juan; Zhang, Nan; Shao, Yu-Xiong; Zhang, Kun; Tong, Zhi-Chao. MicroRNA-545-5p regulates apoptosis, migration and invasion of osteosarcoma by targeting dimethyladenosine transferase 1. Oncology Letters. 2021;22(5):763. PubMed |
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GGLMFNTGIGQHILKNPLIINSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAELHKRVQGTPVASKLQVLVGDVLKTDLPFFDTCV |
| Gene Sequence | GGLMFNTGIGQHILKNPLIINSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAELHKRVQGTPVASKLQVLVGDVLKTDLPFFDTCV |
| Gene ID - Mouse | ENSMUSG00000021692 |
| Gene ID - Rat | ENSRNOG00000013596 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DIMT1 pAb (ATL-HPA042944) | |
| Datasheet | Anti DIMT1 pAb (ATL-HPA042944) Datasheet (External Link) |
| Vendor Page | Anti DIMT1 pAb (ATL-HPA042944) at Atlas Antibodies |
| Documents & Links for Anti DIMT1 pAb (ATL-HPA042944) | |
| Datasheet | Anti DIMT1 pAb (ATL-HPA042944) Datasheet (External Link) |
| Vendor Page | Anti DIMT1 pAb (ATL-HPA042944) |
| Citations for Anti DIMT1 pAb (ATL-HPA042944) – 2 Found |
| Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24. PubMed |
| Zhou, Hai-Zhen; Chen, Bo; Li, Xiao-Ju; Du, Juan-Juan; Zhang, Nan; Shao, Yu-Xiong; Zhang, Kun; Tong, Zhi-Chao. MicroRNA-545-5p regulates apoptosis, migration and invasion of osteosarcoma by targeting dimethyladenosine transferase 1. Oncology Letters. 2021;22(5):763. PubMed |