Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
![Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human cell line A-431<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/40748/16584/atl-hpa000166_anti-dkc1-pab-atl-hpa000166_27165__82064.1783621851.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EAGTYIRTLCVHLGLLLGVGGQMQELRRVRSGVMSEKDHMVTMHDVLDAQWLYDNHKDESYLRRVVYPLEKLLTSHKRLVMKDSAVNAICYGAKIMLPGVLRYEDGIEVNQEIVVIT |
| Gene Sequence | EAGTYIRTLCVHLGLLLGVGGQMQELRRVRSGVMSEKDHMVTMHDVLDAQWLYDNHKDESYLRRVVYPLEKLLTSHKRLVMKDSAVNAICYGAKIMLPGVLRYEDGIEVNQEIVVIT |
| Gene ID - Mouse | ENSMUSG00000031403 |
| Gene ID - Rat | ENSRNOG00000055562 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DKC1 pAb (ATL-HPA000166) | |
| Datasheet | Anti DKC1 pAb (ATL-HPA000166) Datasheet (External Link) |
| Vendor Page | Anti DKC1 pAb (ATL-HPA000166) at Atlas Antibodies |
| Documents & Links for Anti DKC1 pAb (ATL-HPA000166) | |
| Datasheet | Anti DKC1 pAb (ATL-HPA000166) Datasheet (External Link) |
| Vendor Page | Anti DKC1 pAb (ATL-HPA000166) |
| Citations for Anti DKC1 pAb (ATL-HPA000166) – 4 Found |
| Montanaro, Lorenzo; Calienni, Maria; Ceccarelli, Claudio; Santini, Donatella; Taffurelli, Mario; Pileri, Stefano; Treré, Davide; Derenzini, Massimo. Relationship between dyskerin expression and telomerase activity in human breast cancer. Cellular Oncology : The Official Journal Of The International Society For Cellular Oncology. 30(6):483-90. PubMed |
| Sieron, P; Hader, C; Hatina, J; Engers, R; Wlazlinski, A; Müller, M; Schulz, W A. DKC1 overexpression associated with prostate cancer progression. British Journal Of Cancer. 2009;101(8):1410-6. PubMed |
| Koskimaa, Hanna-Mari; Kurvinen, Kaisa; Costa, Silvano; Syrjänen, Kari; Syrjänen, Stina. Molecular markers implicating early malignant events in cervical carcinogenesis. Cancer Epidemiology, Biomarkers & Prevention : A Publication Of The American Association For Cancer Research, Cosponsored By The American Society Of Preventive Oncology. 2010;19(8):2003-12. PubMed |
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EAGTYIRTLCVHLGLLLGVGGQMQELRRVRSGVMSEKDHMVTMHDVLDAQWLYDNHKDESYLRRVVYPLEKLLTSHKRLVMKDSAVNAICYGAKIMLPGVLRYEDGIEVNQEIVVIT |
| Gene Sequence | EAGTYIRTLCVHLGLLLGVGGQMQELRRVRSGVMSEKDHMVTMHDVLDAQWLYDNHKDESYLRRVVYPLEKLLTSHKRLVMKDSAVNAICYGAKIMLPGVLRYEDGIEVNQEIVVIT |
| Gene ID - Mouse | ENSMUSG00000031403 |
| Gene ID - Rat | ENSRNOG00000055562 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DKC1 pAb (ATL-HPA000166) | |
| Datasheet | Anti DKC1 pAb (ATL-HPA000166) Datasheet (External Link) |
| Vendor Page | Anti DKC1 pAb (ATL-HPA000166) at Atlas Antibodies |
| Documents & Links for Anti DKC1 pAb (ATL-HPA000166) | |
| Datasheet | Anti DKC1 pAb (ATL-HPA000166) Datasheet (External Link) |
| Vendor Page | Anti DKC1 pAb (ATL-HPA000166) |
| Citations for Anti DKC1 pAb (ATL-HPA000166) – 4 Found |
| Montanaro, Lorenzo; Calienni, Maria; Ceccarelli, Claudio; Santini, Donatella; Taffurelli, Mario; Pileri, Stefano; Treré, Davide; Derenzini, Massimo. Relationship between dyskerin expression and telomerase activity in human breast cancer. Cellular Oncology : The Official Journal Of The International Society For Cellular Oncology. 30(6):483-90. PubMed |
| Sieron, P; Hader, C; Hatina, J; Engers, R; Wlazlinski, A; Müller, M; Schulz, W A. DKC1 overexpression associated with prostate cancer progression. British Journal Of Cancer. 2009;101(8):1410-6. PubMed |
| Koskimaa, Hanna-Mari; Kurvinen, Kaisa; Costa, Silvano; Syrjänen, Kari; Syrjänen, Stina. Molecular markers implicating early malignant events in cervical carcinogenesis. Cancer Epidemiology, Biomarkers & Prevention : A Publication Of The American Association For Cancer Research, Cosponsored By The American Society Of Preventive Oncology. 2010;19(8):2003-12. PubMed |
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |