Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KERKSLPEEDVAEIQHAEEFLIKPESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACGSNPLKREIGDYIRTGFINLDKPSNPSSHEVVAWIRRILRVEKTGHSGTL |
| Gene Sequence | KERKSLPEEDVAEIQHAEEFLIKPESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACGSNPLKREIGDYIRTGFINLDKPSNPSSHEVVAWIRRILRVEKTGHSGTL |
| Gene ID - Mouse | ENSMUSG00000031403 |
| Gene ID - Rat | ENSRNOG00000055562 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DKC1 pAb (ATL-HPA000447) | |
| Datasheet | Anti DKC1 pAb (ATL-HPA000447) Datasheet (External Link) |
| Vendor Page | Anti DKC1 pAb (ATL-HPA000447) at Atlas Antibodies |
| Documents & Links for Anti DKC1 pAb (ATL-HPA000447) | |
| Datasheet | Anti DKC1 pAb (ATL-HPA000447) Datasheet (External Link) |
| Vendor Page | Anti DKC1 pAb (ATL-HPA000447) |
| Citations for Anti DKC1 pAb (ATL-HPA000447) – 2 Found |
| Bolander, Asa; Agnarsdóttir, Margrét; Strömberg, Sara; Ponten, Fredrik; Hesselius, Patrik; Uhlen, Mathias; Bergqvist, Michael. The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas. Cancer Genomics & Proteomics. 2008;5(6):293-300. PubMed |
| von Stedingk, Kristoffer; Koster, Jan; Piqueras, Marta; Noguera, Rosa; Navarro, Samuel; Påhlman, Sven; Versteeg, Rogier; Ora, Ingrid; Gisselsson, David; Lindgren, David; Axelson, Håkan. snoRNPs Regulate Telomerase Activity in Neuroblastoma and Are Associated with Poor Prognosis. Translational Oncology. 2013;6(4):447-57. PubMed |
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KERKSLPEEDVAEIQHAEEFLIKPESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACGSNPLKREIGDYIRTGFINLDKPSNPSSHEVVAWIRRILRVEKTGHSGTL |
| Gene Sequence | KERKSLPEEDVAEIQHAEEFLIKPESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACGSNPLKREIGDYIRTGFINLDKPSNPSSHEVVAWIRRILRVEKTGHSGTL |
| Gene ID - Mouse | ENSMUSG00000031403 |
| Gene ID - Rat | ENSRNOG00000055562 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DKC1 pAb (ATL-HPA000447) | |
| Datasheet | Anti DKC1 pAb (ATL-HPA000447) Datasheet (External Link) |
| Vendor Page | Anti DKC1 pAb (ATL-HPA000447) at Atlas Antibodies |
| Documents & Links for Anti DKC1 pAb (ATL-HPA000447) | |
| Datasheet | Anti DKC1 pAb (ATL-HPA000447) Datasheet (External Link) |
| Vendor Page | Anti DKC1 pAb (ATL-HPA000447) |
| Citations for Anti DKC1 pAb (ATL-HPA000447) – 2 Found |
| Bolander, Asa; Agnarsdóttir, Margrét; Strömberg, Sara; Ponten, Fredrik; Hesselius, Patrik; Uhlen, Mathias; Bergqvist, Michael. The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas. Cancer Genomics & Proteomics. 2008;5(6):293-300. PubMed |
| von Stedingk, Kristoffer; Koster, Jan; Piqueras, Marta; Noguera, Rosa; Navarro, Samuel; Påhlman, Sven; Versteeg, Rogier; Ora, Ingrid; Gisselsson, David; Lindgren, David; Axelson, Håkan. snoRNPs Regulate Telomerase Activity in Neuroblastoma and Are Associated with Poor Prognosis. Translational Oncology. 2013;6(4):447-57. PubMed |