Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RSWEEHVTHWMGQPFNSDDRNTACHHGLVADSLQASMEKDATLNVDRKEKCVSLPDCCHGSELRDFPGRPMGHLSKDVDENDSHEGEDQFLSLEASTETLVHVSDEDNNADLCLTDDKQVLNTQGQ |
| Gene Sequence | RSWEEHVTHWMGQPFNSDDRNTACHHGLVADSLQASMEKDATLNVDRKEKCVSLPDCCHGSELRDFPGRPMGHLSKDVDENDSHEGEDQFLSLEASTETLVHVSDEDNNADLCLTDDKQVLNTQGQ |
| Gene ID - Mouse | ENSMUSG00000031523 |
| Gene ID - Rat | ENSRNOG00000043053 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DLC1 pAb (ATL-HPA017753) | |
| Datasheet | Anti DLC1 pAb (ATL-HPA017753) Datasheet (External Link) |
| Vendor Page | Anti DLC1 pAb (ATL-HPA017753) at Atlas Antibodies |
| Documents & Links for Anti DLC1 pAb (ATL-HPA017753) | |
| Datasheet | Anti DLC1 pAb (ATL-HPA017753) Datasheet (External Link) |
| Vendor Page | Anti DLC1 pAb (ATL-HPA017753) |
| Citations for Anti DLC1 pAb (ATL-HPA017753) – 2 Found |
| Muehlich, S; Hampl, V; Khalid, S; Singer, S; Frank, N; Breuhahn, K; Gudermann, T; Prywes, R. The transcriptional coactivators megakaryoblastic leukemia 1/2 mediate the effects of loss of the tumor suppressor deleted in liver cancer 1. Oncogene. 2012;31(35):3913-23. PubMed |
| Goeppert, Benjamin; Ernst, Christina; Baer, Constance; Roessler, Stephanie; Renner, Marcus; Mehrabi, Arianeb; Hafezi, Mohammadreza; Pathil, Anita; Warth, Arne; Stenzinger, Albrecht; Weichert, Wilko; Bähr, Marion; Will, Rainer; Schirmacher, Peter; Plass, Christoph; Weichenhan, Dieter. Cadherin-6 is a putative tumor suppressor and target of epigenetically dysregulated miR-429 in cholangiocarcinoma. Epigenetics. 2016;11(11):780-790. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RSWEEHVTHWMGQPFNSDDRNTACHHGLVADSLQASMEKDATLNVDRKEKCVSLPDCCHGSELRDFPGRPMGHLSKDVDENDSHEGEDQFLSLEASTETLVHVSDEDNNADLCLTDDKQVLNTQGQ |
| Gene Sequence | RSWEEHVTHWMGQPFNSDDRNTACHHGLVADSLQASMEKDATLNVDRKEKCVSLPDCCHGSELRDFPGRPMGHLSKDVDENDSHEGEDQFLSLEASTETLVHVSDEDNNADLCLTDDKQVLNTQGQ |
| Gene ID - Mouse | ENSMUSG00000031523 |
| Gene ID - Rat | ENSRNOG00000043053 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DLC1 pAb (ATL-HPA017753) | |
| Datasheet | Anti DLC1 pAb (ATL-HPA017753) Datasheet (External Link) |
| Vendor Page | Anti DLC1 pAb (ATL-HPA017753) at Atlas Antibodies |
| Documents & Links for Anti DLC1 pAb (ATL-HPA017753) | |
| Datasheet | Anti DLC1 pAb (ATL-HPA017753) Datasheet (External Link) |
| Vendor Page | Anti DLC1 pAb (ATL-HPA017753) |
| Citations for Anti DLC1 pAb (ATL-HPA017753) – 2 Found |
| Muehlich, S; Hampl, V; Khalid, S; Singer, S; Frank, N; Breuhahn, K; Gudermann, T; Prywes, R. The transcriptional coactivators megakaryoblastic leukemia 1/2 mediate the effects of loss of the tumor suppressor deleted in liver cancer 1. Oncogene. 2012;31(35):3913-23. PubMed |
| Goeppert, Benjamin; Ernst, Christina; Baer, Constance; Roessler, Stephanie; Renner, Marcus; Mehrabi, Arianeb; Hafezi, Mohammadreza; Pathil, Anita; Warth, Arne; Stenzinger, Albrecht; Weichert, Wilko; Bähr, Marion; Will, Rainer; Schirmacher, Peter; Plass, Christoph; Weichenhan, Dieter. Cadherin-6 is a putative tumor suppressor and target of epigenetically dysregulated miR-429 in cholangiocarcinoma. Epigenetics. 2016;11(11):780-790. PubMed |